SecReT6
Effector Protein ID: 76817268
-
SecReT6 ID96
T6SS typeA3
Gene symbol-
Locus tagBURPS1710b_A2076
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]2525243..2525770 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorYPK_3563
DescriptionHcp protein
UniProt IDQ3JGS6
KEGG IDbpm:BURPS1710b_A2076
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-32, Aligned region: 9..150
Protein Sequence: 175 a.a.     [Download]
>gi|76817268|ref|YP_337227.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MANALVDYFLQIDGVEGESTDQQYPGLIQIQSWQWAEENSGRWGFGSGGGAGKVEMKDFEFRMVSNKASP
KLFLMCATGEHIQNAKLICRKSGKGQQEFLTISFASGLVSSFRTLGNMPISQLGHASGEVDGVLPTDQIR
INFAQIEFEYREQRNDGTMGAVIKAGYDLKQNAPI
-
Nucleotide Sequence: 528 bp     [Download]
>gi|76817237|ref|NC_007435.1|:2525243-2525770 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGGCAAATGCTTTGGTTGATTACTTCTTGCAGATCGATGGCGTCGAGGGTGAGTCGACCGATCAGCAAT
ATCCCGGTCTGATCCAGATCCAGAGCTGGCAGTGGGCGGAAGAGAACTCGGGCCGCTGGGGCTTCGGCAG
CGGCGGCGGCGCGGGCAAGGTCGAGATGAAGGACTTCGAGTTCCGCATGGTGTCGAACAAGGCGTCGCCG
AAGCTGTTCCTGATGTGCGCGACGGGTGAGCACATCCAGAACGCGAAGCTGATCTGCCGCAAGTCGGGCA
AGGGCCAGCAGGAGTTCCTGACGATCTCGTTCGCGAGCGGCCTCGTGTCGTCGTTCCGCACGCTCGGCAA
CATGCCGATCTCGCAGCTCGGTCACGCGAGCGGCGAAGTCGACGGCGTGCTGCCGACGGATCAGATCCGC
ATCAACTTCGCCCAGATCGAGTTCGAGTACCGCGAGCAGCGCAACGACGGCACGATGGGCGCCGTGATCA
AGGCGGGCTACGACCTGAAGCAGAACGCGCCGATCTAA