SecReT6
Effector Protein ID: 76819027
-
SecReT6 ID92
T6SS typeA1
Gene symbol-
Locus tagBURPS1710b_A0541
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]729560..732583 [+]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBMAA0737
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ3JL53
KEGG IDbpm:BURPS1710b_A0541
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.10E-67, Aligned region: 46..349
Phage_base_V [PF04717], Evalue: 2.80E-16, Aligned region: 396..489
Protein Sequence: 1007 a.a.     [Download]
>gi|76819027|ref|YP_335700.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MPSSPRHDAPASRAHAAPSANARRFTFASDAYDPATFDVVDINGRDAISQPYRFEITLVSRQLRIDFAKM
LSRGATLAILPPFGEAGTTRYAGVLAEFEQKKRFRDFTVYRATLVPRLWRLSLYKASDVYLNEQTIPDIV
KRVLRAASFGSRDFRMRHGGGYRKRSFVCQYDESHLDFVSRWMEKEGLYYYFEHDGRHETLVIVDDRRHQ
PGPADDLALRYLPVTSLDAGIESDRVQAFTCRATPLPREVVLRDFNHRKAELSLEVRERVARDGVGERVS
SDEHFHTKDEGQRYAKLRAEALVCEGRRFAGESTAAGLRAGRFFALSGHYREDFDGRYLVTALTHRGSQA
HLLFPDLDAPFGATPGEPIYRAEFEAIAADLQYRPPRTTPKPRAAGVVSAIVDGEGGGKLAELDEYGQYK
VRFPFAHTAHPANKASARIRMATPYAGDDRGMHLPLLKRTEVKIAFDGGDPDRPVIVGAVPNSSHRSVVT
RRNPAEHRILTEHNQLYMKDGSGAATWLHAPNNHIGIGAVGPGDGLALLTSGNKFDFSLGNAYSFSGGLK
CSVSMGGNTDVYVGVRNSLDVSANFLTTLQGNLRWMLPGSRSFEINDSASTLLQTLHKQSATGAIRLSAG
QDASALLQKQLDKLKGTVRKFMIVSGLANAGSAAAAAGLIKGGGKLADLPWAGFGISAAQFAGATGVSTA
LMATSRTLLANVAKLQEALPLVADLSLGKQGIALAAKNLTHATRMSLTVDGVSWSTHAKGPGAAGAAMSV
GKGRWGVEAAKHAHVHASDTLLFAVPADPTTQFDLKDLIGLRRDLDECMKDIADLEADISENEVLSTDQN
TFGVSALIPTPPSPAGALAAVAIKVKQAKLVELKAKQKLVALKVDNLQQKFAKHVQHLSAVRMSASDAQL
GFKGNRLVATADGVTLAHAQGKAKLDVREAKIGVTAGKSSVELDEGKIAAGCGSASLKLGSDGAIDVSAT
DVKLNGTNVKLNGSASLKFDGQLIQLG
-
Nucleotide Sequence: 3024 bp     [Download]
>gi|76817237|ref|NC_007435.1|:729560-732583 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGCCTTCGTCCCCCCGCCACGATGCGCCCGCGTCGCGCGCGCACGCCGCGCCGTCCGCGAACGCGCGAC
GCTTCACGTTCGCGAGCGACGCGTACGACCCCGCGACGTTCGACGTCGTCGACATCAACGGCCGCGACGC
GATCTCGCAGCCGTACCGGTTCGAGATCACGCTCGTGAGCAGGCAGTTGCGGATCGACTTCGCGAAGATG
CTGAGCCGCGGGGCGACGCTCGCGATCCTGCCGCCGTTCGGCGAGGCCGGCACCACCCGCTATGCCGGCG
TGCTCGCCGAATTCGAGCAGAAGAAACGCTTTCGCGACTTCACCGTCTATCGCGCGACGCTCGTGCCGCG
CCTCTGGCGGCTGTCGCTGTACAAGGCGTCGGACGTCTATCTGAACGAGCAGACGATTCCCGACATCGTC
AAGCGCGTGCTGCGCGCCGCCTCGTTCGGCAGCCGCGATTTCCGCATGCGGCACGGCGGCGGCTACCGCA
AGCGCAGCTTCGTCTGCCAATACGACGAGAGCCATCTCGATTTCGTGTCGCGCTGGATGGAGAAGGAAGG
CCTCTACTACTACTTCGAGCATGACGGCCGGCACGAAACGCTCGTGATCGTCGACGACCGCCGCCATCAG
CCCGGCCCCGCCGACGATCTCGCGCTGCGCTACCTACCCGTGACCAGCCTCGACGCGGGCATCGAATCGG
ACCGCGTGCAGGCGTTCACATGCCGGGCGACGCCGCTGCCGCGCGAAGTCGTGCTGCGCGATTTCAACCA
CCGCAAGGCGGAGCTCTCGCTCGAAGTCCGCGAGCGCGTGGCGCGCGACGGCGTCGGCGAGCGGGTGTCG
AGCGACGAGCACTTCCACACGAAGGACGAAGGGCAGCGCTACGCGAAGCTGCGCGCCGAGGCGCTCGTCT
GCGAAGGGCGCCGATTCGCCGGCGAATCGACCGCGGCCGGGCTGCGCGCCGGCCGCTTCTTCGCGCTGTC
GGGCCACTACCGCGAGGATTTCGACGGCCGCTATCTGGTGACGGCGCTCACGCATCGCGGCTCGCAGGCA
CACCTGCTGTTTCCCGATCTCGACGCGCCGTTCGGCGCGACGCCGGGCGAGCCCATCTACCGCGCCGAGT
TCGAGGCGATTGCCGCCGACCTCCAGTACCGGCCGCCGCGCACGACGCCCAAGCCGCGCGCGGCGGGCGT
CGTCAGCGCGATCGTCGACGGCGAGGGCGGCGGCAAGCTCGCCGAGCTCGACGAATACGGCCAGTACAAG
GTGCGCTTTCCGTTCGCGCACACCGCGCATCCGGCGAACAAGGCCTCCGCGCGCATCCGGATGGCGACGC
CCTACGCGGGCGACGACCGCGGCATGCACCTGCCGCTGCTGAAGCGCACCGAAGTGAAGATCGCATTCGA
CGGCGGCGATCCGGACCGCCCCGTGATCGTCGGCGCGGTGCCCAACTCGTCGCACCGCAGCGTCGTCACG
CGCCGCAACCCCGCCGAGCATCGCATCCTCACCGAGCACAACCAGCTCTACATGAAGGACGGCAGCGGCG
CGGCGACGTGGCTGCACGCGCCGAACAACCACATCGGCATCGGCGCGGTCGGGCCGGGCGACGGCCTCGC
GCTCCTCACGTCCGGCAACAAGTTCGACTTCTCGCTCGGCAACGCGTACAGCTTCTCGGGCGGGCTCAAG
TGCTCGGTGTCGATGGGCGGCAACACCGACGTCTACGTCGGCGTGCGCAACAGCCTCGACGTCAGCGCGA
ACTTCCTGACGACGCTGCAGGGCAACCTGCGCTGGATGCTGCCCGGCAGCCGGAGCTTCGAGATCAACGA
CAGCGCATCGACACTGCTGCAGACGCTGCACAAGCAGTCCGCGACGGGCGCGATCCGGCTGTCCGCCGGG
CAGGACGCGTCCGCGCTGCTGCAAAAGCAGCTCGACAAGCTCAAGGGCACGGTGCGCAAGTTCATGATCG
TGTCGGGCCTCGCGAACGCCGGGTCCGCGGCCGCCGCCGCGGGGCTCATCAAGGGCGGCGGCAAGCTCGC
CGATCTGCCGTGGGCGGGCTTCGGCATATCCGCCGCGCAGTTCGCCGGTGCGACCGGCGTCAGCACGGCG
CTGATGGCGACCTCGCGCACGCTGCTCGCGAACGTCGCGAAGCTCCAGGAGGCGTTGCCGCTCGTCGCCG
ATCTGTCGCTCGGCAAGCAGGGCATCGCGCTCGCCGCGAAGAACCTCACGCACGCGACGCGGATGTCGCT
CACCGTCGACGGCGTCTCGTGGTCGACGCACGCGAAGGGGCCCGGCGCGGCGGGCGCCGCGATGAGCGTC
GGCAAGGGCCGCTGGGGCGTCGAAGCGGCGAAGCACGCGCACGTCCACGCGAGCGACACGCTGCTGTTCG
CGGTGCCGGCCGACCCGACGACCCAGTTCGACCTGAAGGACCTGATCGGGCTGCGCCGCGATCTCGACGA
ATGCATGAAGGACATCGCCGATCTCGAAGCCGACATTTCGGAAAACGAAGTGCTGTCGACCGATCAGAAC
ACGTTCGGCGTCAGCGCGCTCATCCCCACGCCGCCGTCGCCCGCCGGCGCGCTCGCGGCGGTCGCGATCA
AGGTGAAGCAAGCGAAGCTCGTCGAGCTGAAGGCCAAGCAGAAGCTCGTCGCGCTGAAGGTCGACAACCT
GCAGCAGAAGTTCGCGAAGCACGTGCAGCACCTGAGCGCCGTGCGGATGAGCGCTTCCGACGCGCAGCTC
GGCTTCAAGGGCAACCGGCTCGTCGCGACGGCCGACGGCGTCACGCTCGCGCATGCGCAGGGCAAGGCGA
AGCTCGACGTGCGCGAAGCGAAGATCGGCGTCACGGCGGGCAAATCGAGCGTCGAGCTCGACGAAGGCAA
GATCGCGGCCGGCTGCGGCAGCGCATCGCTGAAGCTCGGCAGCGACGGCGCGATCGACGTGAGCGCGACC
GACGTCAAGCTGAACGGCACCAACGTCAAGCTGAACGGCAGCGCGTCGCTGAAGTTCGACGGCCAACTGA
TCCAGCTCGGCTGA