SecReT6
Effector Protein ID: 76819388
-
SecReT6 ID92
T6SS typeA1
Gene symbol-
Locus tagBURPS1710b_A0535
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]722666..723175 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBMAA0742
DescriptionHcp protein
UniProt IDQ3JL59, Q3JL59
KEGG IDbpm:BURPS1710b_A0535
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-24, Aligned region: 6..155
Protein Sequence: 169 a.a.     [Download]
>gi|76819388|ref|YP_335694.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MLAGIYLKVKGKTQGEIKGSVVQEGHDGKIHILAFKNDYDMPARLQEGLTPAAAARGTITLTKEMDRSSP
QFLQALGKREMMEEFEITIHRPKTDTTGGDLTELLFTYKFEKVLITHMDQYSPTPHKDDSNGIKEGLLGY
IEEIKFTYSGYSLEHAESGIAGAANWTNG
-
Nucleotide Sequence: 510 bp     [Download]
>gi|76817237|ref|NC_007435.1|:722666-723175 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGCTGGCCGGAATATATCTCAAGGTCAAAGGAAAAACCCAGGGGGAAATCAAAGGCTCCGTCGTTCAGG
AAGGTCATGACGGGAAAATCCACATCCTCGCCTTCAAGAACGACTACGACATGCCTGCCAGGCTCCAGGA
AGGCCTGACGCCCGCCGCCGCCGCTCGCGGCACGATCACGTTGACGAAGGAAATGGACAGATCGTCGCCG
CAATTCCTGCAGGCGCTCGGCAAGCGCGAGATGATGGAAGAGTTCGAGATCACGATCCACCGTCCGAAGA
CGGATACAACAGGTGGGGACCTGACCGAACTCCTGTTCACGTACAAGTTCGAAAAAGTGCTGATCACCCA
CATGGACCAATACTCGCCCACGCCGCACAAAGACGATAGCAACGGCATCAAGGAAGGCTTGCTCGGCTAT
ATCGAGGAGATCAAGTTCACGTATTCGGGATACTCGTTGGAACACGCGGAATCGGGCATCGCGGGCGCCG
CAAACTGGACGAATGGCTGA