SecReT6
Effector Protein ID: 77458555
-
SecReT6 ID97
T6SS typeA4a
Gene symbol-
Locus tagPfl01_2328
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]2683657..2684172 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPSPTO_5435
DescriptionHcp protein
UniProt IDQ3KDT5
KEGG IDpfo:Pfl01_2328
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-40, Aligned region: 6..156
Protein Sequence: 171 a.a.     [Download]
>gi|77458555|ref|YP_348060.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MATPAYMSVTGEKQGLITAGAFTADSVGNTYQEGHEDQVMVQAFTHDVIIPRDPQSGQPTGQRVHKPVVI
TKVYDKASPLLQAALTSGERMSEIVIQWYRTSAQGTQEHYYTTKLEDAIIVAINNKMHNCQDPANAHFTH
LEEVHFTYRKITWTHEVSGTSGSDDWRAPVV
-
Nucleotide Sequence: 516 bp     [Download]
>gi|255961261|ref|NC_007492.2|:2683657-2684172 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGGCAACACCAGCGTACATGTCGGTTACCGGCGAAAAACAAGGCCTGATCACTGCCGGCGCGTTCACCG
CCGACTCCGTTGGCAACACCTACCAGGAAGGTCATGAAGACCAAGTCATGGTTCAGGCGTTCACCCACGA
TGTGATCATTCCGCGTGACCCGCAATCCGGTCAGCCAACCGGTCAGCGCGTGCACAAGCCAGTCGTGATC
ACCAAGGTCTACGACAAGGCTTCGCCACTGCTGCAAGCCGCTCTGACCTCCGGCGAGCGCATGAGCGAAA
TCGTTATCCAGTGGTATCGCACTTCGGCGCAAGGCACCCAAGAGCACTACTACACCACCAAACTGGAAGA
CGCGATCATCGTCGCCATCAACAACAAGATGCACAACTGCCAGGATCCGGCAAACGCCCACTTCACTCAT
CTGGAAGAAGTGCATTTTACCTACCGCAAAATCACCTGGACCCACGAAGTCTCCGGTACTTCGGGTTCCG
ATGACTGGCGTGCTCCGGTCGTTTAA