SecReT6
Effector Protein ID: 78060722
-
SecReT6 ID104
T6SS typeA4b
Gene symbol-
Locus tagBcep18194_C7609
StrainBurkholderia sp. 383
Repliconchromosome 1 [GenBank: NC_007509] [Browse all T6SS(s) in this replicon]
Location [Strand]1247197..1250040 [-]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBTH_I2693
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ39LL3
KEGG IDbur:Bcep18194_C7609
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.90E-64, Aligned region: 42..355
Phage_GPD [PF05954], Evalue: 6.90E-64, Aligned region: 688..798
DUF2345 [PF10106], Evalue: 9.20E-41, Aligned region: 747..911
T6SS_Vgr [PF13296], Evalue: 1.10E-24, Aligned region: 298..319
T6SS_Vgr [PF13296], Evalue: 1.10E-24, Aligned region: 589..690
T6SS_Vgr [PF13296], Evalue: 1.10E-24, Aligned region: 820..870
Phage_base_V [PF04717], Evalue: 2.90E-13, Aligned region: 442..544
Phage_base_V [PF04717], Evalue: 2.90E-13, Aligned region: 721..783
Protein Sequence: 947 a.a.     [Download]
>gi|78060722|ref|YP_367297.1| Rhs element Vgr protein [Burkholderia sp. 383]
MSTNMDVLKKLAGDWSQYDRFLWVTTPLGANALVAESLHGWEAVDHGGYRFQLTALSGNAALPLERLIGA
PILVEWRAREGSDVRRPVHGHIIAAERIGYNGGLARFRLEVEPWLAVLRQRVDHYNFQNASVLDISEQIF
GYHTAGTVAPAWRWALADPARYRKRSLTTQAGESDFDFLQRLWAEEGIFYWFEHAGDAHTSSLGKHTLVL
ADSNQHFTPDKPEVIGFHQTSDGDPAGSIQHFMTARRWRIGRVARASWDHRTLSNRLTGAQADGVAMAGE
DRDVAGPYAFQTAALGDQRARQQLDAQRVAALCSEGRSTCMALHPGMRFAISGHPALKASDAFVCLRVQH
SVRANVDADVHAAIEQTLGDIPPMLDTDVNEYGVAHALHAALGSGTHDGAPLVGNEAVYANSFVALPAGQ
TYRPLSEGGHGARSHPVVAVQGAQTAIVVGAGDPVHTDRDHRVRIQHHAQRGQKAASLEDHPHAANAPAD
RNAGTWTRVLTPVGGDNWGGVTVPRVGQEVWTDWLEGQPDRPVVVGSLYNGQGNADAQHNAQAGGPASST
GNAAAWFAGNGHPAALTGIKTQDLNLSQQGTGGYRQFLLDDTAGEASARLYTTDHNSGLTLGHLKQIQDN
QRQADRGYGMELTTDAAAALRGGSGMLVSAARGASQMDASAAGQVLTQNRQLLDGLAEAARAQGAEPAQP
AASVGAGADDAGHATGPGTSTQSAAVTGLQQSEQALAEKRDGRTSAQAGGGSGSAAAWSRPHVVAHGADG
LAAVTPGSQVWVSGTETVLSAGQDLQWTAKGKTTLAATHGVAFYTQGNAAGERPVAGQGIALHAASGAVS
LQAQNAGTLGAAAQQAVVLSSSQGAANLQAPKRLLLNAAKAYLKMEGGNIEVGAPGRVEFKSAQRELTGP
RGAGGQTSLGSSSAKDCQLRLSGAAASHDSVVMLPAG
-
Nucleotide Sequence: 2844 bp     [Download]
>gi|78059643|ref|NC_007509.1|:c1250040-1247197 Burkholderia sp. 383 chromosome 3, complete genome
ATGTCGACGAATATGGACGTTCTGAAAAAACTCGCCGGAGACTGGTCGCAGTACGACCGGTTTCTCTGGG
TCACCACGCCGCTGGGCGCGAACGCGCTGGTCGCCGAGAGTCTGCACGGGTGGGAGGCGGTCGATCACGG
CGGCTACCGGTTTCAGTTGACGGCATTGTCCGGGAACGCGGCGTTGCCGCTGGAGCGCCTGATCGGCGCG
CCGATCCTGGTCGAATGGCGTGCGCGTGAAGGCAGCGACGTCCGCCGCCCCGTTCACGGTCACATCATTG
CGGCGGAGCGGATCGGCTACAACGGCGGGCTGGCCCGCTTTCGTCTCGAAGTCGAGCCGTGGCTCGCGGT
GCTCCGCCAGCGCGTCGATCACTACAATTTCCAGAACGCCAGCGTGCTCGACATCAGCGAGCAGATTTTC
GGCTATCACACCGCGGGCACCGTGGCACCCGCGTGGCGCTGGGCGCTGGCCGATCCCGCCAGATACCGCA
AGCGCAGCCTGACCACCCAGGCCGGTGAATCCGACTTCGATTTCCTGCAGCGGCTGTGGGCCGAAGAGGG
CATCTTCTACTGGTTCGAGCATGCCGGCGACGCCCATACGTCCAGCCTCGGCAAGCACACGCTCGTGCTC
GCCGATTCGAACCAGCACTTCACGCCGGACAAGCCGGAGGTCATCGGCTTTCACCAGACGAGCGACGGCG
ATCCGGCGGGCAGCATCCAGCATTTCATGACCGCGCGTCGCTGGCGGATCGGCCGGGTCGCACGCGCGAG
CTGGGATCACCGCACGCTGTCGAACCGGTTGACCGGCGCGCAGGCCGACGGCGTCGCGATGGCTGGCGAA
GATCGTGACGTTGCCGGCCCGTATGCGTTCCAGACCGCCGCACTCGGCGATCAGCGCGCGCGCCAGCAAC
TCGACGCGCAACGCGTCGCCGCGCTGTGCAGCGAAGGGCGCAGCACCTGCATGGCGCTGCATCCGGGAAT
GCGTTTCGCGATCAGCGGGCATCCGGCGCTGAAGGCGTCGGACGCGTTCGTGTGCCTGCGCGTTCAGCAC
AGCGTGCGCGCGAACGTCGATGCGGACGTGCACGCCGCGATCGAGCAGACGCTCGGCGACATACCGCCGA
TGCTGGATACCGACGTGAACGAGTACGGCGTCGCCCATGCGCTGCACGCCGCGCTCGGCAGCGGGACGCA
CGATGGCGCGCCGCTGGTGGGCAACGAAGCGGTCTATGCGAACAGCTTCGTCGCGTTGCCGGCCGGACAG
ACGTACCGGCCGCTGAGCGAAGGCGGTCACGGCGCACGCTCGCATCCCGTGGTGGCCGTACAGGGTGCGC
AAACGGCGATCGTCGTCGGCGCGGGCGATCCGGTTCACACCGATCGCGATCACCGGGTCCGGATCCAGCA
CCATGCGCAGCGCGGGCAGAAGGCCGCGAGTCTCGAGGATCATCCGCACGCGGCCAACGCGCCGGCCGAC
CGGAATGCCGGCACATGGACACGCGTGCTGACGCCGGTCGGCGGCGACAACTGGGGCGGCGTGACCGTGC
CGCGCGTCGGGCAGGAAGTGTGGACCGACTGGCTCGAGGGGCAACCGGACCGGCCGGTGGTGGTGGGTTC
GCTGTACAACGGCCAGGGCAATGCCGATGCGCAGCACAACGCGCAAGCGGGCGGTCCGGCCAGCAGTACC
GGCAATGCGGCCGCGTGGTTCGCAGGCAATGGCCACCCCGCGGCACTGACGGGCATCAAGACGCAGGACC
TGAACCTGAGCCAGCAAGGGACGGGCGGCTATCGGCAGTTCCTGCTCGACGACACGGCCGGCGAGGCGAG
TGCGCGTCTTTATACGACGGACCACAACAGCGGGTTGACGCTGGGTCATCTCAAGCAGATTCAGGACAAC
CAGCGGCAAGCCGATCGCGGGTATGGCATGGAGTTGACGACCGACGCTGCCGCTGCGTTGCGCGGCGGCT
CGGGCATGCTCGTCAGCGCGGCGCGTGGCGCCAGCCAGATGGACGCGAGTGCGGCGGGCCAGGTGCTGAC
CCAGAACCGTCAACTGCTCGACGGCCTCGCGGAGGCGGCGCGCGCGCAAGGTGCCGAGCCGGCACAGCCC
GCGGCAAGCGTCGGCGCGGGGGCGGATGACGCGGGGCATGCGACGGGGCCCGGCACGTCGACGCAATCGG
CCGCCGTGACCGGGTTGCAGCAGAGCGAGCAGGCGCTGGCCGAAAAGCGCGACGGCCGAACGTCTGCCCA
GGCCGGCGGCGGAAGCGGTAGCGCTGCCGCATGGTCGCGTCCGCATGTCGTCGCGCATGGCGCGGACGGT
CTCGCCGCCGTGACGCCCGGCAGCCAGGTCTGGGTGTCGGGGACGGAGACCGTGCTGAGCGCCGGCCAGG
ATCTGCAATGGACGGCCAAGGGCAAGACAACCCTGGCGGCGACGCACGGCGTCGCGTTCTATACACAGGG
CAACGCCGCGGGCGAGCGGCCCGTCGCCGGGCAAGGCATCGCGTTGCACGCGGCCTCCGGCGCGGTAAGC
CTGCAGGCGCAGAATGCGGGCACGCTCGGCGCGGCCGCGCAGCAGGCGGTCGTGCTGTCGAGCAGCCAGG
GCGCGGCGAATCTGCAGGCACCGAAGCGTCTGCTGCTGAATGCCGCGAAAGCGTACCTGAAGATGGAGGG
CGGCAATATCGAGGTCGGCGCGCCGGGGCGGGTGGAATTCAAGTCGGCGCAGCGCGAACTGACCGGGCCG
CGAGGCGCGGGCGGGCAAACCTCGTTGGGCAGCAGCAGCGCGAAGGATTGCCAGTTGCGCCTGTCGGGCG
CGGCCGCGAGCCACGACAGCGTCGTCATGCTGCCGGCGGGCTGA