SecReT6
Effector Protein ID: 78060725
-
SecReT6 ID104
T6SS typeA4b
Gene symbol-
Locus tagBcep18194_C7612
StrainBurkholderia sp. 383
Repliconchromosome 1 [GenBank: NC_007509] [Browse all T6SS(s) in this replicon]
Location [Strand]1251227..1254571 [-]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBTH_I2697
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ39LL0
KEGG IDbur:Bcep18194_C7612
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.00E-51, Aligned region: 35..340
Phage_GPD [PF05954], Evalue: 7.00E-51, Aligned region: 639..740
DUF2345 [PF10106], Evalue: 1.30E-44, Aligned region: 668..821
T6SS_Vgr [PF13296], Evalue: 1.60E-29, Aligned region: 516..623
Phage_base_V [PF04717], Evalue: 1.50E-15, Aligned region: 384..497
Protein Sequence: 1114 a.a.     [Download]
>gi|78060725|ref|YP_367300.1| Rhs element Vgr protein [Burkholderia sp. 383]
MDIAAALKGYSQATRQIQIDTAMPGAFAVERFHGREAMDESFRFEIDVLSSTPFLDLNPLLGTAIRLRLA
TGAGERCWNGYVVRAAYSDSDGEITRYRLTMASWLELLRLRRNCLYFVGLDTEGICERVFGDYPEAHRRY
ELKEPLRTFDLRGQYRETDFDFVMRQLSEAGLSFRIEHAQDAGEKPSGNHTVVVFDRRAEPPKGSTVAYN
RQDVGDPDGVLTYFTTRHQLVPDRVTAASWKASNLVALAGHAEGEADRDAPAMPAREVLDAQRAGRFETS
DQAQRYASQRLDALRLSKRIHYGAGSSRTLEIGKVHTLTGYPDGTVSFVPLTLEHEAVNNLGADIAQLLE
HGELEQGLYRNRFAAVPPGVPIVPPHRDRPVVQGVQTAIVVGEPSNRVSSTRDHQVRVQFPWMRGTAPLP
GGLTDTASRSNPQGHAPGDHRSGVVARIAEQAAGPNFGHSFTPRIGAEVVVGFDSGNIDMPVVLGQLYGG
RVQPPFAAGEGSSANHAGVLTGMQTQTLDGTAGSRWVMDDASGQLRHELGNSVANSRLAQGYLIDQQGAV
RGAYRGEGFDLATEGWGVVRAGDGVLVSGTARTEAASTQMDLGESVAQLKQAVKTAQGLDEAAARATAGR
LTANAAQADFLKAIDPAQDGKYTGAVNGQSATKPAAGGTGGSGDPVERFAVPAVVLESPQNVVMSTGNSA
VSYAEKHVHLTAQGDAHLAAGATVAGASGDAASVYAAAGGIKAVAGHGPVSVEAHASSMQILADQSVCIT
SSDDRIDVLAKDAIVLQQGPSRITLKGADILVETPGSFAVKAGAHPFMGPGAQSPVLPAFPIPVPLALYD
EQLRFVNADGVPLSKVAYQLKLADGTTASGVTDDAGKTERVASASPLGILSALLTPTQMVDCCGRTSGTP
PAPVEVKIKGVQTNQFQLGESEKSVEVDAHERVLTAGEIEMARTVFKDGIDYDKVRVHKGSYFWFNLQNK
NTAVTPNGKMYFLDDLYVDDFSAMNGPNIWKRSLFMHEMTHVWQYQLGYAVRWHALTVTIRGQSAYEYTV
APGAVFHDYNMEQQGNLVADYYAVQVLKAPFAVFHRGYVGTPFELDHVLAPLLEDPKNADNLPK
-
Nucleotide Sequence: 3345 bp     [Download]
>gi|78059643|ref|NC_007509.1|:c1254571-1251227 Burkholderia sp. 383 chromosome 3, complete genome
ATGGACATTGCTGCTGCATTGAAGGGCTATTCGCAGGCGACTCGCCAGATCCAGATCGATACGGCGATGC
CGGGCGCTTTCGCGGTCGAGCGGTTTCATGGCCGGGAAGCGATGGACGAGTCCTTCCGGTTCGAGATCGA
CGTGCTGTCGAGCACGCCGTTCCTCGACCTGAATCCGCTGCTCGGCACGGCGATCCGCCTGCGTCTCGCG
ACCGGCGCGGGCGAGCGCTGCTGGAACGGGTACGTCGTGCGGGCCGCGTACAGCGACAGCGACGGCGAGA
TCACGCGCTACCGGCTGACCATGGCCTCCTGGCTCGAACTGCTCCGGCTGCGCCGCAACTGCCTGTATTT
CGTCGGCCTCGATACCGAGGGCATCTGCGAGCGCGTGTTCGGCGACTATCCGGAGGCGCATCGGCGCTAT
GAACTGAAGGAGCCGTTGCGCACGTTCGATCTGCGTGGCCAGTATCGCGAAACCGACTTCGACTTCGTGA
TGCGCCAGTTGTCCGAGGCCGGCCTGTCGTTTCGGATCGAGCATGCACAGGACGCCGGCGAGAAACCGTC
CGGCAACCATACCGTCGTGGTGTTCGACCGGCGCGCCGAACCGCCCAAAGGCAGCACCGTCGCCTATAAC
CGGCAGGACGTGGGCGACCCCGACGGCGTATTGACCTATTTCACCACGCGGCACCAACTGGTCCCGGATC
GCGTCACGGCCGCGAGCTGGAAAGCCAGCAATCTCGTTGCGCTCGCCGGGCATGCCGAGGGCGAGGCCGA
TCGCGATGCACCCGCGATGCCCGCGCGCGAAGTGCTGGACGCGCAGCGTGCCGGCCGCTTCGAGACGTCG
GACCAGGCGCAGCGCTACGCGTCGCAGCGTCTGGACGCGCTGCGCCTGTCGAAGCGGATTCACTATGGCG
CCGGCTCGTCGCGTACGCTGGAGATCGGCAAGGTTCACACGCTGACCGGCTATCCGGACGGTACGGTTTC
GTTCGTCCCGCTGACGCTCGAGCACGAGGCGGTCAACAATCTCGGTGCCGATATCGCGCAACTGCTCGAG
CACGGCGAACTGGAGCAGGGGCTCTATCGCAACCGCTTTGCCGCGGTGCCGCCGGGCGTGCCGATCGTGC
CGCCTCATCGCGACCGGCCGGTCGTGCAGGGCGTGCAGACCGCGATCGTCGTCGGCGAGCCGTCGAACCG
GGTGAGCAGCACGCGCGACCACCAGGTGCGCGTGCAGTTTCCGTGGATGCGCGGCACGGCGCCGCTGCCG
GGCGGACTGACCGACACCGCGAGCCGGTCGAACCCGCAGGGGCATGCGCCCGGCGACCATCGATCCGGCG
TGGTTGCGCGCATCGCCGAACAGGCGGCGGGCCCGAACTTCGGCCACAGCTTTACGCCGCGCATCGGCGC
GGAAGTCGTGGTCGGCTTCGACTCGGGAAACATCGACATGCCGGTCGTGCTGGGCCAGCTTTACGGCGGC
CGCGTGCAGCCCCCGTTCGCGGCCGGTGAAGGCAGCAGCGCGAATCACGCGGGCGTGCTGACCGGCATGC
AGACGCAGACACTCGACGGCACGGCGGGCAGCCGCTGGGTGATGGACGATGCGTCGGGCCAGTTGCGTCA
TGAACTGGGCAACAGCGTCGCGAACAGCCGGCTTGCGCAAGGCTATCTGATCGATCAGCAGGGCGCGGTT
CGCGGTGCCTATCGTGGCGAAGGTTTTGATCTCGCGACCGAAGGCTGGGGCGTCGTGCGGGCGGGCGACG
GTGTGCTCGTGTCGGGCACCGCGCGCACGGAAGCGGCTTCGACGCAAATGGATCTGGGAGAAAGCGTTGC
CCAGTTGAAGCAGGCGGTGAAGACCGCACAGGGTCTCGACGAGGCGGCGGCGCGTGCAACGGCCGGCCGG
CTGACGGCGAACGCCGCGCAGGCGGATTTCCTGAAGGCGATCGATCCCGCGCAGGACGGCAAGTACACGG
GTGCGGTGAACGGGCAGAGCGCGACCAAACCGGCTGCCGGCGGAACCGGCGGCAGCGGGGATCCGGTCGA
GCGCTTCGCGGTGCCGGCCGTCGTGCTGGAGTCGCCGCAAAACGTCGTGATGAGTACCGGCAACAGTGCG
GTGTCCTATGCGGAGAAGCACGTGCACCTGACCGCGCAGGGCGATGCGCATCTGGCTGCCGGCGCGACGG
TCGCCGGTGCGTCCGGCGATGCGGCGAGCGTGTACGCGGCCGCAGGCGGAATCAAGGCCGTGGCCGGCCA
CGGGCCGGTCAGTGTCGAGGCGCATGCGTCGTCGATGCAGATCCTGGCCGACCAGTCGGTGTGCATCACG
TCGTCGGATGACCGGATCGACGTGCTCGCGAAGGATGCGATCGTGCTTCAGCAAGGGCCGAGCCGGATCA
CGCTGAAGGGCGCGGACATCCTGGTCGAGACGCCCGGATCGTTTGCCGTCAAGGCGGGTGCCCATCCGTT
CATGGGGCCGGGTGCGCAGTCGCCGGTGCTGCCGGCCTTCCCGATTCCCGTGCCGCTCGCGCTTTACGAC
GAGCAACTGCGCTTCGTCAACGCGGACGGCGTGCCGCTGTCGAAGGTTGCCTATCAGTTGAAGCTGGCCG
ACGGCACCACGGCGTCGGGCGTGACCGATGACGCGGGCAAGACCGAGCGCGTGGCGTCGGCGAGCCCGCT
GGGGATCCTGTCGGCGCTGCTGACCCCGACCCAGATGGTGGACTGCTGCGGACGCACGTCGGGTACGCCG
CCAGCGCCGGTCGAAGTCAAGATCAAGGGCGTGCAGACGAACCAGTTTCAGTTGGGGGAATCGGAGAAGT
CGGTCGAGGTCGACGCCCATGAGCGGGTGCTGACCGCGGGCGAAATTGAAATGGCCCGGACAGTCTTCAA
GGACGGTATCGACTACGACAAGGTGCGGGTGCACAAAGGGAGTTACTTCTGGTTCAACCTGCAAAACAAG
AACACCGCCGTCACGCCGAACGGGAAGATGTATTTCCTTGACGACCTGTACGTCGACGATTTCTCGGCAA
TGAACGGCCCGAACATCTGGAAAAGAAGCCTGTTCATGCACGAAATGACCCATGTCTGGCAGTACCAGCT
TGGGTATGCGGTGCGATGGCATGCGCTGACCGTCACGATTCGAGGACAGAGCGCATACGAATACACCGTC
GCGCCAGGTGCGGTATTTCACGATTACAACATGGAGCAGCAGGGCAACCTGGTCGCGGATTACTACGCCG
TGCAGGTGCTGAAGGCGCCTTTCGCCGTCTTTCATCGTGGCTACGTCGGCACGCCGTTCGAGCTCGATCA
TGTCCTTGCTCCGCTCCTCGAGGATCCCAAGAATGCAGACAATCTTCCGAAGTAG