SecReT6
Effector Protein ID: 78060728
-
SecReT6 ID104
T6SS typeA4b
Gene symbol-
Locus tagBcep18194_C7615
StrainBurkholderia sp. 383
Repliconchromosome 1 [GenBank: NC_007509] [Browse all T6SS(s) in this replicon]
Location [Strand]1256647..1259601 [-]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBTH_I2705
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ39LK7
KEGG IDbur:Bcep18194_C7615
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.00E-48, Aligned region: 37..356
DUF2345 [PF10106], Evalue: 2.10E-43, Aligned region: 739..901
T6SS_Vgr [PF13296], Evalue: 1.30E-30, Aligned region: 579..686
T6SS_Vgr [PF13296], Evalue: 1.30E-30, Aligned region: 736..767
Phage_base_V [PF04717], Evalue: 2.80E-14, Aligned region: 423..519
Protein Sequence: 984 a.a.     [Download]
>gi|78060728|ref|YP_367303.1| Rhs element Vgr protein [Burkholderia sp. 383]
MDVNSQLSSLFSALNRLHVLDGPGSISSLQIERWSGREALSEIYRWDVYALSTDPGLDLDAMVGQRVTLT
TTLANGSTTTRSGLVAEAGCVGYDGTLARYHLQLVPWLEALAHGRDQRTFVNRTVAEVLDTVFAAYRSSA
RWRFTADANQRIDALGPCEYRVQYRTHTHLDFVCHVLAEAGLGFCFVEDDDAPAGHTLLVFDDSAQLPED
DTSRRLGGLPLRLNGMAVGTGDVILGMGQVVSLTADRVTLISSDYRGNQSVTATASVVNPAGFRELYDDV
GPEAFATLRAAEDTARRQADAILSEARCWAGCSTLHTARAGRALRVANAPWQQVRGSAETPDTFLVTEVT
HVGINNLPRTVMEALQQTLGTLPPDDLDPRVLKEAGIGGYANRFTSVPREQVWRPILEDGTGQRLNPVPT
ALGAQSAIVVGPQGESQPGATGPVHTDAQGRLKLRYHWQADGDTGVFATRAMQRLAGDGHGLQQTQRIGH
EVLVQFMNGLVHRPVILGGLFNGRGEGGESPTPGGETGQPLDESIYAKAADHAPSAQGNQVGGYSPAWHG
GGAGTQRHNHAGALSGFKSQGFDAQGHNQLVTDDSDGMGRLQMATTHAATQFNLGHLRHQADNYLGSFRG
QGVELRSDAYGAVRATRGVLISSYAPDPAQPAGDVAALKSLLAQQLALARTFDKAADTHRTLPLAAQRGV
RKAGESSLDGEAAPLDALSRSLATTVSANGFEQATADAAQRGTGNALPHTGDALLGIAARGGQGLFAGQA
LQWAAGETLTIGSGGDTNLAVSRSLRVHSGQGIGWLAGANGTGAASEAGLSLIAGKDNLDLQAQHGTLAL
RAKDDLTVAATKSDVELAAGQALRLAVSGGASLLIEGGNVTFECPGNLTVHAADHQFQGPTDLDKAKGAW
GDHGLYNEYYWLRDAQTGGAVKGLPYRMVGTHGDALAARSSAGDGRTATYSTQAAAKPIRVEYTGNEDID
HGWS
-
Nucleotide Sequence: 2955 bp     [Download]
>gi|78059643|ref|NC_007509.1|:c1259601-1256647 Burkholderia sp. 383 chromosome 3, complete genome
ATGGATGTTAACTCGCAACTGTCGTCTCTGTTCAGTGCTTTGAATCGTCTTCACGTACTCGACGGGCCCG
GTTCGATCTCGTCCTTGCAGATCGAACGCTGGAGCGGCCGCGAAGCGCTGTCGGAGATCTATCGCTGGGA
CGTCTACGCACTCTCCACCGACCCCGGGCTCGATCTCGATGCGATGGTCGGGCAGCGCGTCACCCTCACC
ACGACGCTGGCGAACGGATCGACGACGACCCGTAGCGGGCTCGTGGCCGAGGCCGGATGCGTCGGCTATG
ACGGCACGCTGGCACGCTACCATCTGCAACTGGTGCCATGGCTGGAGGCGCTCGCGCACGGCCGTGATCA
GCGCACGTTCGTGAACCGGACGGTTGCCGAGGTGCTCGACACTGTGTTCGCGGCCTACCGCAGCAGCGCC
CGCTGGCGTTTCACCGCCGATGCCAACCAGCGTATCGACGCGCTCGGGCCGTGCGAATACCGCGTGCAGT
ACCGCACCCACACGCATCTCGATTTCGTGTGCCACGTGCTGGCGGAAGCCGGCCTCGGCTTCTGCTTCGT
CGAGGACGATGACGCGCCGGCGGGCCATACGCTGCTCGTCTTCGACGACAGCGCGCAGCTCCCCGAGGAC
GACACCTCTCGGCGCCTCGGCGGCCTGCCGCTTCGCCTGAACGGCATGGCGGTCGGCACCGGCGACGTGA
TCCTGGGCATGGGCCAGGTCGTCTCGCTGACGGCCGACCGGGTGACGCTGATCAGCAGTGACTATCGCGG
CAACCAGTCGGTGACGGCGACGGCGAGCGTGGTCAATCCGGCCGGCTTTCGCGAGCTGTACGACGACGTC
GGGCCGGAAGCGTTCGCGACGCTGCGCGCGGCCGAGGACACGGCGCGCCGGCAGGCCGATGCGATCCTGT
CCGAGGCGCGCTGCTGGGCGGGCTGCAGCACGCTGCATACGGCGCGGGCCGGCCGGGCGCTGCGCGTCGC
CAACGCGCCATGGCAACAGGTGCGCGGCTCGGCGGAAACGCCGGACACCTTTCTCGTCACCGAAGTGACC
CATGTCGGTATCAACAACCTGCCGCGTACCGTGATGGAAGCGCTGCAGCAGACGCTTGGCACGCTGCCGC
CGGACGATCTCGATCCGCGCGTGCTGAAGGAGGCGGGGATCGGCGGTTACGCGAACCGTTTCACGAGCGT
GCCGCGCGAGCAGGTCTGGCGCCCCATCCTCGAGGACGGGACGGGCCAGCGGCTGAATCCGGTGCCGACG
GCGCTGGGCGCGCAATCCGCGATCGTGGTCGGCCCGCAGGGCGAGTCGCAACCGGGCGCCACCGGCCCGG
TTCACACGGACGCGCAGGGCCGGTTGAAGCTGCGCTACCACTGGCAGGCGGATGGCGACACGGGCGTGTT
CGCGACGCGCGCGATGCAGCGACTGGCCGGCGACGGTCATGGCCTGCAGCAGACGCAGCGGATCGGCCAT
GAAGTGCTGGTGCAGTTCATGAACGGCCTCGTGCATCGGCCGGTGATCCTCGGCGGCTTGTTCAACGGTC
GCGGCGAAGGCGGCGAATCGCCGACACCGGGCGGCGAGACGGGCCAGCCGCTCGACGAGTCGATCTACGC
GAAGGCGGCCGATCATGCGCCGAGCGCGCAGGGCAACCAGGTCGGGGGGTACAGCCCGGCGTGGCACGGC
GGCGGCGCGGGCACGCAGCGGCACAACCACGCGGGGGCGCTGTCCGGCTTCAAGAGCCAGGGATTCGACG
CACAGGGCCACAATCAGTTGGTGACGGACGACAGCGACGGCATGGGGCGCCTGCAGATGGCGACGACGCA
CGCCGCGACCCAGTTCAACCTCGGTCACCTGCGTCACCAGGCGGACAACTATCTCGGCAGTTTTCGCGGC
CAGGGCGTCGAGCTGCGTTCCGATGCATATGGCGCCGTGCGCGCGACGCGCGGCGTCCTGATTTCGAGCT
ATGCGCCGGATCCGGCGCAACCCGCCGGCGACGTCGCCGCGCTGAAGTCGTTGCTGGCGCAACAGTTGGC
GCTGGCGCGCACCTTCGACAAGGCGGCCGACACCCACCGCACGTTGCCGCTTGCCGCGCAGCGCGGCGTG
CGCAAGGCGGGCGAGTCGTCGCTCGACGGCGAAGCCGCACCGCTCGACGCGCTGTCGCGCAGCCTGGCGA
CTACGGTGAGCGCGAACGGGTTCGAGCAGGCCACGGCCGACGCAGCGCAACGCGGCACCGGCAACGCGCT
GCCGCATACGGGCGACGCGTTGCTGGGCATCGCCGCTCGCGGCGGCCAGGGGCTGTTCGCGGGCCAGGCG
CTGCAGTGGGCTGCGGGCGAGACGCTGACGATCGGCAGCGGGGGCGATACCAACCTGGCGGTCAGCCGGT
CGTTGCGGGTCCACAGCGGCCAGGGCATCGGCTGGCTGGCCGGCGCGAACGGGACGGGCGCGGCGAGCGA
GGCCGGCCTCAGCCTGATTGCGGGCAAGGACAACCTGGACCTGCAGGCACAGCACGGCACGCTGGCACTG
CGCGCGAAGGACGACCTGACGGTGGCCGCGACGAAGAGCGACGTCGAACTGGCCGCCGGGCAGGCACTGC
GGCTCGCCGTGAGCGGCGGCGCGTCGCTGCTGATCGAGGGCGGCAATGTCACGTTCGAGTGCCCGGGCAA
CCTGACGGTTCACGCGGCCGACCATCAGTTCCAGGGGCCGACCGACCTGGACAAGGCGAAGGGCGCGTGG
GGCGATCACGGGCTCTACAACGAGTATTACTGGCTGCGCGACGCGCAGACGGGCGGCGCGGTGAAGGGGC
TGCCTTACCGGATGGTCGGCACGCATGGCGATGCGCTGGCTGCGCGCAGCAGCGCCGGCGACGGGCGGAC
GGCGACCTATTCGACCCAGGCCGCGGCGAAACCGATCCGGGTCGAATACACCGGCAACGAGGACATCGAT
CATGGCTGGAGCTGA