SecReT6
Effector Protein ID: 78061832
-
SecReT6 ID105
T6SS typeA3
Gene symbol-
Locus tagBcep18194_B0982
StrainBurkholderia sp. 383
Repliconchromosome 2 [GenBank: NC_007511] [Browse all T6SS(s) in this replicon]
Location [Strand]1098922..1099407 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSciK
DescriptionHcp protein
UniProt IDQ398L5
KEGG IDbur:Bcep18194_B0982
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.40E-44, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|78061832|ref|YP_371740.1| hypothetical protein Bcep18194_B0982 [Burkholderia sp. 383]
MSQDIFLKIDGINGESLDDKHKDEIEILNWDWEIQQESSMHSGSGGGAGKATVKDLTFEHNIDRASPNLM
KYALTGKHIDQAVLVMRKAGGNPLEYLKLTMSDVIVTRVKPSGSKAGEEKSRETVSLSFSKVKQEYVVQN
AQGGSGGAVTASFDIKGNKEA
-
Nucleotide Sequence: 486 bp     [Download]
>gi|78060853|ref|NC_007511.1|:1098922-1099407 Burkholderia sp. 383 chromosome 2, complete sequence
ATGTCGCAGGACATTTTTCTGAAGATCGACGGCATCAACGGTGAATCGCTCGATGACAAGCACAAGGACG
AAATCGAGATCCTGAACTGGGACTGGGAAATCCAGCAGGAATCGTCGATGCACTCGGGCAGCGGCGGCGG
TGCCGGCAAGGCAACGGTCAAGGATCTCACGTTCGAACACAACATCGACCGTGCGAGCCCGAACCTGATG
AAGTATGCGCTGACGGGCAAGCACATCGACCAGGCCGTGCTGGTGATGCGCAAGGCCGGCGGCAATCCGC
TCGAGTACCTGAAGCTCACGATGAGCGACGTGATCGTCACGCGCGTGAAGCCGTCCGGCAGCAAGGCCGG
TGAAGAGAAGAGCCGCGAGACGGTGTCGCTGTCGTTCTCGAAGGTCAAGCAGGAGTATGTCGTGCAGAAC
GCGCAGGGCGGCAGCGGCGGCGCCGTCACGGCGAGCTTCGACATCAAGGGCAACAAGGAAGCGTAA