SecReT6
Effector Protein ID: 78065037
-
SecReT6 ID104
T6SS typeA4b
Gene symbol-
Locus tagBcep18194_A3561
StrainBurkholderia sp. 383
Repliconchromosome 1 [GenBank: NC_007510] [Browse all T6SS(s) in this replicon]
Location [Strand]426923..427426 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBCAL0343
DescriptionHcp protein
UniProt IDQ39K54
KEGG IDbur:Bcep18194_A3561
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.70E-43, Aligned region: 7..139
Protein Sequence: 167 a.a.     [Download]
>gi|78065037|ref|YP_367806.1| unnamed protein product [Burkholderia sp. 383]
MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMIFTKEIDSSSP
LLYQHASGGTTFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVREEGLPLETFSLKYAAVQWKQT
QQKIGGNQGGNTQGAWSLTKNDKTYAV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|78064658|ref|NC_007510.1|:426923-427426 Burkholderia sp. 383 chromosome 1, complete sequence
ATGTTACATATGCACTTGCAGTTTGGTAGTCCCGCGGTGAAGGGCGAATCCGCGGACAAGGACCACCAGG
GCTGGATCGAGCTGAAATCGTGGGATCACTCGATCGTTCAACCGCGTTCGGCAACCGCATCGACCGCAGG
CGGTCACACGATGACGCGTTGCGAACACGGCGACATGATTTTCACGAAGGAAATCGATTCGTCGAGCCCG
CTGCTGTACCAACACGCTTCGGGCGGCACCACGTTCGACGAGGTGACGGTCCATTTCTCGCGCGCTGACG
GTGAAGGCAAGCGCGTGCAGTATCTGGAAGTCAAGCTCAAGTACGTGATCATCTCGAGCATCGCCCCGAG
CGTTCGCGAAGAAGGTCTGCCGCTCGAGACGTTCTCGCTGAAGTACGCAGCTGTGCAGTGGAAGCAAACC
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAAGGCGCCTGGAGTCTGACGAAGAACGACAAGA
CCTACGCGGTCTAA