SecReT6
Effector Protein ID: 83716109
-
SecReT6 ID115
T6SS typeA4b
Gene symbol-
Locus tagBTH_II0090
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]100528..102714 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_II0090
Description
UniProt IDQ2T957
KEGG IDbte:BTH_II0090
PDB IDNA
Domain hit(s) vs Pfam DUF3274 [PF11678], Evalue: 1.20E-120, Aligned region: 398..707
Abhydrolase_6 [PF12697], Evalue: 0.0001, Aligned region: 20..44
Abhydrolase_6 [PF12697], Evalue: 0.0001, Aligned region: 208..307
PGAP1 [PF07819], Evalue: 0.0037, Aligned region: 20..25
PGAP1 [PF07819], Evalue: 0.0037, Aligned region: 226..283
DUF900 [PF05990], Evalue: 0.0062, Aligned region: 19..28
DUF900 [PF05990], Evalue: 0.0062, Aligned region: 196..265
Protein Sequence: 728 a.a.     [Download]
>gi|83716109|ref|YP_438292.1| unnamed protein product [Burkholderia thailandensis E264]
MANRPGDRPVPIPRDLPGVVIFIHGVNDPGAAYATVERGLCQGLNERLSRSDLRPAEYGREYAEAIKAKD
RKSPFFDSKIANDPDMYLYRRAESGGAHSMFLPFYWGYRASDNEIAKINHPGEIKSRVADSDGNLMTRGQ
YQDIHGNRLDAHFGKGGGFFANATNNIPQMYSRGFEPDKLERTVMQNALAGNTIFAGKSPERRYFVLAAA
RLANLIKTIRTIQPSALALEHGMDPQHETITVMGHSQGTIITLLAQAMLKQQGQRCVDCIIMVDTPYSLQ
FTKDGSQQTGHAKLKTLVDIVNAVTSEPHTIPDLAELMIDSAHSCGRAGQNWSQTQGKRLDKSGKHWITF
DERDNRGKVYLYFCPEDTVVGLDKVRGIGTFGVPDEVPADGAAASRGKTMPAMTALEPKRFFQRMWTRLE
RDQDGRGRRSKVAVGTPPARVPVRDPFQRLTPGPDTDGTMLGTLVESGKNMALQASFKRNDIRLINGEQL
KPAYEPDLYGGEVQKGGQVPGHADVAGLMRPDDVTKNVALGNQYAKFQWKDVATTDDPGASIEPHKQAFN
RGRPVDEQSHNWRIVPSRSLGSMLSAAATGGRYQTYVIQREETPDEVRKRMRTDADQLEANNYHSGVLLS
SENHRWVTAMDVAIGQAVTLDDPDWRQLLLLMADWKMTPDVYRNIQKCKNFERLDEHTREFVKACVDYYK
TGRFPDEKYVPLILPPLVTSELKVESKT
-
Nucleotide Sequence: 2187 bp     [Download]
>gi|83716035|ref|NC_007650.1|:100528-102714 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGGCGAATCGGCCGGGCGACCGGCCCGTGCCGATTCCGCGCGATCTGCCGGGCGTGGTGATCTTCATTC
ACGGCGTCAACGATCCCGGTGCGGCTTATGCCACTGTGGAGCGCGGGCTGTGCCAGGGGCTCAATGAGCG
ATTGTCGCGAAGCGATTTGCGGCCGGCGGAATATGGCAGGGAATATGCTGAAGCCATCAAAGCGAAAGAC
CGGAAGAGCCCGTTCTTCGATAGCAAAATCGCCAACGATCCGGACATGTATCTGTATCGACGTGCGGAAA
GTGGCGGTGCCCACAGCATGTTCCTGCCGTTCTACTGGGGCTATCGGGCATCCGACAACGAAATCGCGAA
GATCAACCATCCGGGCGAGATCAAGAGCCGCGTGGCGGACAGCGACGGCAACCTGATGACGCGCGGCCAG
TATCAGGACATCCACGGCAACCGGCTTGACGCCCATTTCGGCAAGGGCGGCGGGTTTTTCGCCAACGCGA
CGAACAACATTCCGCAGATGTATAGCCGGGGTTTCGAACCGGACAAGCTGGAGCGCACGGTCATGCAAAA
CGCGCTCGCCGGCAATACGATCTTCGCCGGCAAGTCGCCCGAGCGCCGTTACTTCGTGCTTGCCGCGGCT
CGCCTGGCGAATCTCATCAAGACCATTCGGACCATTCAGCCCTCCGCGCTCGCGCTCGAACATGGAATGG
ACCCTCAGCACGAAACGATCACGGTGATGGGGCACAGCCAGGGCACGATCATCACGCTGCTCGCGCAGGC
GATGCTCAAGCAGCAAGGGCAGCGCTGCGTGGATTGCATCATCATGGTCGATACGCCGTACAGCCTGCAG
TTCACCAAGGACGGCAGCCAGCAAACCGGGCACGCGAAGCTCAAGACGCTGGTCGACATCGTCAACGCGG
TGACGAGCGAGCCGCATACGATTCCGGATCTGGCCGAACTGATGATCGATTCGGCCCATTCGTGCGGCCG
GGCCGGACAGAACTGGAGCCAGACGCAGGGAAAGCGGCTGGACAAGAGCGGCAAGCACTGGATCACGTTC
GACGAGCGCGACAACCGCGGCAAGGTCTATCTGTACTTCTGCCCGGAAGACACCGTGGTCGGCCTCGACA
AGGTGCGCGGGATCGGCACGTTCGGCGTGCCCGACGAGGTTCCGGCCGATGGCGCGGCGGCCAGCCGGGG
CAAAACGATGCCTGCGATGACGGCGCTTGAGCCGAAGCGCTTCTTTCAGCGCATGTGGACGCGGCTCGAG
CGCGACCAGGACGGCAGGGGGAGGCGCTCGAAGGTCGCCGTCGGCACGCCGCCCGCGCGCGTGCCGGTTC
GCGATCCGTTTCAGCGATTGACGCCGGGCCCCGACACGGACGGCACGATGCTTGGCACCTTGGTCGAATC
CGGCAAGAACATGGCGCTGCAGGCGTCGTTCAAGCGCAACGACATTCGCCTCATCAACGGCGAGCAACTG
AAACCGGCGTACGAGCCCGATCTGTACGGGGGCGAGGTTCAGAAAGGCGGACAGGTGCCGGGGCACGCCG
ATGTCGCCGGGTTGATGCGTCCGGACGACGTGACGAAGAACGTCGCGCTCGGCAACCAGTACGCGAAGTT
CCAGTGGAAGGACGTTGCGACGACGGACGACCCGGGCGCCAGCATCGAGCCGCACAAGCAGGCGTTCAAT
CGCGGCCGTCCGGTCGACGAGCAGTCGCATAACTGGCGCATCGTGCCGAGCCGGTCGCTCGGCTCGATGC
TGTCGGCGGCCGCCACGGGCGGACGGTATCAGACGTACGTGATCCAGCGCGAGGAGACGCCGGACGAGGT
TCGCAAGCGCATGCGCACCGATGCCGATCAACTGGAAGCGAACAACTATCATTCGGGCGTGCTGCTCAGT
TCGGAGAACCATCGCTGGGTCACGGCGATGGATGTGGCGATCGGTCAGGCGGTGACGCTGGATGATCCGG
ACTGGCGGCAGTTGTTGCTTTTGATGGCGGATTGGAAGATGACGCCGGACGTGTATCGAAATATCCAGAA
ATGCAAGAACTTCGAGCGCTTGGACGAACACACGCGCGAATTCGTGAAAGCGTGTGTCGATTACTACAAG
ACCGGCCGATTTCCCGACGAGAAGTATGTACCTCTCATCCTGCCACCGCTCGTGACCAGCGAACTGAAGG
TCGAGAGCAAAACATGA

Reference
(1) Russell AB et al. (2012). A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 11(5):538-49. [PudMed:22607806] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature