SecReT6
Effector Protein ID: 83716550
-
SecReT6 ID113
T6SS typeA1
Gene symbol-
Locus tagBTH_II0868
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]1018597..1019085 [-]
Producthcp protein
Effector typeProtein
Homologous effectorBTH_II0868
DescriptionHcp protein
UniProt IDQ2T6Y4
KEGG IDbte:BTH_II0868
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-40, Aligned region: 6..146
Protein Sequence: 162 a.a.     [Download]
>gi|83716550|ref|YP_439065.1| unnamed protein product [Burkholderia thailandensis E264]
MPMPCYLTLEGQTQGSIEGSCDIQGHEGKILVQAVEHTIEIPKSPQTGLPTSKRLHGPMTLTKEIDKSSP
KLSQALASGEQMKSVVLEFYRILKEGKEEHYYTVKLENAILTSIRSWTPNCLVLDNKQLGHMEDVSFTYE
KITWTYVPDGIEAEDSWRAPKV
-
Nucleotide Sequence: 489 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c1019085-1018597 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGCCGATGCCGTGCTATCTCACGCTCGAAGGGCAAACCCAGGGCAGCATCGAGGGTTCCTGCGACATCC
AGGGCCACGAGGGCAAGATTCTCGTCCAGGCCGTCGAGCACACGATCGAGATCCCGAAGAGCCCGCAAAC
GGGCCTGCCGACCAGCAAGCGGCTCCACGGGCCGATGACGCTGACCAAGGAGATCGACAAGTCGTCGCCG
AAGCTGTCTCAGGCGCTCGCGTCCGGCGAGCAGATGAAGTCGGTCGTGCTCGAGTTCTACCGGATTCTGA
AGGAAGGCAAGGAAGAGCACTACTACACGGTCAAGCTCGAGAACGCGATCCTCACGAGCATCCGCTCCTG
GACGCCGAACTGCCTCGTGCTCGACAACAAGCAGCTCGGCCACATGGAAGACGTATCGTTCACGTACGAG
AAGATCACGTGGACCTACGTGCCGGACGGCATCGAGGCCGAGGACTCATGGCGCGCGCCGAAGGTGTGA

Reference
(1) Schwarz S et al. (2014). VgrG-5 is a Burkholderia type VI secretion exported protein required for multinucleated giant cell formation and virulence. Infect Immun. 82(4):1445-52. [PudMed:24452686] experimental
 
experimental experimental literature