SecReT6
Effector Protein ID: 83716745
-
SecReT6 ID115
T6SS typeA4b
Gene symbol-
Locus tagBTH_II0089
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]97680..100460 [+]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBTH_I3225
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ2STN0
KEGG IDbte:BTH_I3225, bte:BTH_II0089
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-56, Aligned region: 47..378
DUF2345 [PF10106], Evalue: 2.10E-42, Aligned region: 614..647
DUF2345 [PF10106], Evalue: 2.10E-42, Aligned region: 699..849
T6SS_Vgr [PF13296], Evalue: 3.10E-38, Aligned region: 563..671
T6SS_Vgr [PF13296], Evalue: 3.10E-38, Aligned region: 738..803
Phage_base_V [PF04717], Evalue: 9.10E-19, Aligned region: 462..546
Protein Sequence: 926 a.a.     [Download]
>gi|83716745|ref|YP_438291.1| unnamed protein product [Burkholderia thailandensis E264]
MTNLNDTLRNFASGAVDWNKRPVALHFGAAQGALGHLLALQHASVQEGLMTGIGGRLTCVSTRRDIPPGV
FLGMPVSIRLITDRGQPHMVNAIISDVQIGQSDGELCVYQLTVCDALSLMDKRTNSRVFRKRSVIDVLAT
LFNEWQQRSPALARAFEFDLSGLRADRYPPRELTRQVNESDAHFVRRLLRREGITVFAKAGPAKGEQPLQ
GDATVHTLVCCDEPMSLPQAPAGTVRLHPRDAGTEQRDTVTLFALRRQLVPGKAGRPSWDYKKARIDESS
VASSLDQGEAGNDLAKLLTDIAIDIPHAGDSWSDHERLTRARMLAHEFEAERYDGVSSVRDLAVGAWITL
TGDPDWDRQLADKRQFVITSIDHDIWNNLPKGLNDRVHALFAASRNLVNAPGALPAALANDADTRYENTF
TCVRRGVPLAPAYDPQADLPPVHLLTGTIVGAEGEEVFCDENGRVRVRVHGLDPADHAHAQGAGTNDNAG
DSAPIRVASSLAGAHFGASFLPRVGMEVLLGCLGGDPDRLVIIGVLGNGANPPATFSHAGGLPGNRYLSG
IKTKEIKGQRYNQLRLDDTPNQISAQLASEHAHSQLNLGYLTQPRENGHGNDRGEGAELRTDAAAALRAA
QGILLTTYARTQASGGQLDRDELIRLLGECSELFKALGDYAGQHGGQAADTAGQHAVAAAFRNWTPGAGG
ADAPPDGGDRALMAFGAQAGSVNVTPKTHVTYAGENIDQVAQQHLQLMSGQRLNATAGQGMQLFARGAGV
QAVAGEGPMLLQAQADTLTANAQKGVKITTNEHEVFVSAPRIRLVAEDGSYLEIGNGITLGTNGDIKLLS
ASHQWGGPSTAQAAKTAFDNQPTDQRFKLHYPGEDGDLPAAANKPFRITLNDGRVIEGKTDASGLTDLVK
DDAMRIAKIDYLKPKL
-
Nucleotide Sequence: 2781 bp     [Download]
>gi|83716035|ref|NC_007650.1|:97680-100460 Burkholderia thailandensis E264 chromosome II, complete sequence
GTGACCAATTTGAACGATACGCTACGCAATTTTGCGTCGGGGGCGGTCGACTGGAATAAACGTCCGGTCG
CGTTGCACTTTGGCGCCGCGCAAGGCGCGCTGGGCCACCTCCTCGCGTTGCAACACGCCAGTGTTCAGGA
AGGTCTGATGACCGGGATTGGCGGGCGATTGACCTGTGTTTCGACCCGTCGCGACATCCCACCCGGCGTG
TTTCTCGGCATGCCGGTCTCGATCCGGCTCATTACCGATCGCGGACAGCCGCACATGGTGAACGCGATCA
TCAGCGACGTCCAGATCGGCCAAAGCGACGGCGAGCTCTGTGTGTACCAGCTGACGGTCTGCGACGCGCT
GTCGCTGATGGACAAGCGCACCAATTCGCGGGTCTTCCGAAAGCGCAGCGTCATCGATGTGCTCGCCACG
CTGTTCAACGAATGGCAGCAGCGCAGCCCGGCCCTCGCGCGCGCATTCGAATTCGATCTGTCCGGCTTGC
GCGCCGATCGCTATCCGCCCCGCGAACTGACCCGGCAAGTCAACGAATCGGATGCGCATTTCGTGCGCCG
TCTGCTGCGCCGCGAAGGGATCACCGTGTTCGCGAAGGCGGGGCCGGCGAAGGGCGAACAGCCGTTGCAG
GGCGATGCGACCGTGCACACGCTCGTGTGCTGTGACGAGCCGATGTCGCTGCCGCAAGCGCCGGCCGGCA
CGGTTCGCTTGCATCCGCGCGACGCCGGCACCGAGCAGCGCGACACGGTCACGCTGTTCGCGCTGCGTCG
GCAATTGGTGCCCGGCAAGGCCGGACGCCCGTCGTGGGACTACAAGAAGGCGCGGATCGACGAATCGAGC
GTCGCTTCGAGCCTCGATCAGGGCGAGGCGGGCAACGATCTGGCGAAGCTGCTGACCGACATCGCGATCG
ACATTCCGCACGCGGGCGATTCATGGAGCGATCACGAGCGGCTCACCCGCGCGCGCATGCTCGCGCACGA
GTTCGAGGCCGAGCGCTACGACGGCGTTAGCAGCGTGCGGGATCTGGCCGTGGGCGCGTGGATCACGCTG
ACGGGCGATCCGGACTGGGACAGGCAACTCGCCGACAAGCGCCAGTTCGTGATCACGTCGATCGATCATG
ACATCTGGAACAACCTGCCGAAGGGGCTCAATGACCGCGTGCACGCGCTGTTCGCCGCGAGCCGCAATCT
CGTGAACGCGCCCGGCGCGCTGCCGGCCGCGCTTGCGAACGACGCGGATACGCGCTACGAGAACACGTTC
ACCTGCGTGCGCCGCGGCGTGCCGCTTGCGCCCGCGTACGATCCGCAAGCCGATTTGCCGCCCGTGCATC
TGCTCACGGGCACGATCGTCGGCGCGGAGGGCGAGGAAGTGTTCTGCGACGAAAACGGCCGGGTGCGCGT
GCGGGTGCACGGCCTCGACCCGGCGGACCACGCGCACGCGCAGGGCGCGGGCACCAACGACAACGCGGGC
GACAGCGCGCCGATCCGCGTGGCGTCGAGCCTCGCCGGCGCCCATTTCGGCGCATCGTTTCTGCCGCGAG
TCGGCATGGAAGTCCTCCTCGGCTGTCTCGGCGGCGATCCGGACCGGTTGGTGATCATCGGCGTGCTCGG
TAACGGCGCGAATCCGCCGGCGACGTTCAGCCATGCGGGCGGCTTGCCGGGCAACCGCTACCTGTCCGGC
ATCAAGACGAAGGAGATCAAGGGGCAGCGGTACAACCAGCTGCGTCTCGACGACACGCCGAACCAGATCA
GCGCGCAACTGGCGAGCGAGCATGCGCATTCGCAGCTCAATCTCGGATACCTGACCCAACCGCGCGAGAA
CGGTCATGGCAACGACCGCGGCGAGGGCGCGGAGCTGCGTACCGACGCGGCGGCGGCGCTGCGGGCGGCG
CAAGGCATTCTGCTGACGACCTACGCGCGCACGCAGGCGAGCGGCGGGCAACTGGACCGTGACGAGCTGA
TTCGGTTGCTCGGCGAGTGCTCGGAGCTGTTCAAGGCGCTGGGCGACTACGCGGGGCAGCACGGCGGGCA
GGCTGCGGATACGGCCGGCCAGCACGCGGTGGCCGCCGCCTTCAGGAACTGGACGCCGGGCGCGGGCGGC
GCCGATGCGCCGCCCGACGGCGGAGATCGCGCGCTGATGGCGTTCGGCGCGCAGGCCGGCTCGGTGAACG
TCACGCCGAAGACGCACGTGACGTATGCCGGAGAGAACATCGATCAGGTTGCGCAGCAGCACCTGCAACT
GATGAGCGGCCAGCGGCTGAACGCGACGGCCGGGCAGGGCATGCAACTCTTCGCGCGGGGCGCGGGCGTG
CAGGCCGTGGCGGGCGAAGGGCCGATGCTGCTGCAGGCGCAAGCCGATACGTTGACGGCGAATGCGCAGA
AGGGCGTCAAGATCACGACGAACGAGCACGAGGTGTTCGTGAGCGCGCCGAGGATTCGGCTCGTCGCCGA
GGACGGCAGCTACCTCGAGATCGGCAACGGCATCACGCTCGGCACGAACGGCGACATCAAGCTGCTGTCG
GCGTCGCACCAGTGGGGCGGGCCGTCGACGGCGCAGGCGGCGAAGACCGCGTTCGACAACCAGCCGACGG
ATCAGCGTTTCAAGCTGCACTATCCGGGCGAGGACGGCGATTTGCCGGCTGCGGCGAACAAGCCATTCCG
GATCACGCTGAACGACGGGCGCGTCATCGAGGGCAAGACCGATGCGAGCGGCCTGACGGATCTGGTCAAG
GACGACGCGATGCGTATCGCGAAGATCGACTATCTGAAACCGAAGCTTTGA

Reference
(1) Russell AB et al. (2012). A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 11(5):538-49. [PudMed:22607806] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature