SecReT6
Effector Protein ID: 83716914
-
SecReT6 ID115
T6SS typeA4b
Gene symbol-
Locus tagBTH_II0310
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]379615..380307 [-]
Productantifungal protein
Effector typeProtein
Homologous effectorBTH_II0310
Description
UniProt IDQ2T8I8
KEGG IDbte:BTH_II0310
PDB IDNA
Domain hit(s) vs Pfam B_lectin [PF01453], Evalue: 1.70E-10, Aligned region: 19..65
B_lectin [PF01453], Evalue: 1.70E-10, Aligned region: 109..161
Protein Sequence: 230 a.a.     [Download]
>gi|83716914|ref|YP_438511.1| unnamed protein product [Burkholderia thailandensis E264]
MSQIYGTKPEGALYVGKGDRLVMQTDGRLVFYAGNDVVWSNWYFGPAPIPGSYAVVEDFGVVAIYPPQGG
YPSFTWPFASITPNSGALTTVAGYPFGLNFPVLNGYQSLQVFNNVTHYLWNKSFAADSVAMQPDGNLVVY
NKGGPVWSTGTSGNPGAYMLVTPVGFVLGKQYGGIVANVPYPVSVDQSSRASGPDDPKPATPPPPALNLP
INASWKCYYVRDWLVCYAPG
-
Nucleotide Sequence: 693 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c380307-379615 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGTCGCAAATCTACGGAACGAAGCCCGAGGGCGCGCTCTACGTCGGCAAAGGCGACCGGCTCGTGATGC
AGACCGACGGCCGGCTCGTGTTCTACGCGGGCAACGACGTCGTCTGGAGCAACTGGTATTTCGGCCCCGC
GCCGATTCCGGGCTCGTATGCCGTCGTCGAGGATTTCGGCGTCGTCGCGATCTATCCGCCGCAGGGCGGC
TATCCTTCGTTCACCTGGCCGTTCGCATCGATCACGCCGAACAGCGGCGCGCTCACGACAGTCGCCGGCT
ATCCGTTCGGCCTGAACTTCCCGGTGCTCAACGGATACCAATCGCTGCAGGTCTTCAACAACGTCACCCA
TTACCTGTGGAACAAGAGCTTCGCGGCGGACAGCGTCGCGATGCAGCCCGACGGCAATCTCGTCGTGTAC
AACAAGGGAGGGCCGGTCTGGTCGACGGGAACGTCGGGCAATCCGGGCGCCTACATGCTGGTGACGCCTG
TCGGCTTCGTGCTCGGCAAGCAGTACGGCGGCATCGTCGCGAACGTGCCGTATCCGGTGTCCGTTGACCA
GTCGAGCCGCGCGAGCGGCCCGGACGATCCGAAGCCCGCCACGCCGCCGCCTCCTGCGCTGAACCTGCCG
ATCAACGCGAGCTGGAAGTGCTATTACGTCAGGGACTGGCTCGTGTGCTACGCGCCTGGTTGA

Reference
(1) Russell AB et al. (2012). A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 11(5):538-49. [PudMed:22607806] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature