SecReT6
Effector Protein ID: 83718482
-
SecReT6 ID115
T6SS typeA4b
Gene symbol-
Locus tagBTH_I2693
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3081345..3084173 [-]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBTH_I2693
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ2SV41
KEGG IDbte:BTH_I2693
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.50E-62, Aligned region: 42..355
Phage_GPD [PF05954], Evalue: 3.50E-62, Aligned region: 443..487
DUF2345 [PF10106], Evalue: 1.20E-40, Aligned region: 746..910
T6SS_Vgr [PF13296], Evalue: 7.40E-26, Aligned region: 587..690
T6SS_Vgr [PF13296], Evalue: 7.40E-26, Aligned region: 807..856
Phage_base_V [PF04717], Evalue: 4.20E-11, Aligned region: 442..544
Sarcoglycan_1 [PF04790], Evalue: 0.0072, Aligned region: 788..842
Sarcoglycan_1 [PF04790], Evalue: 0.0072, Aligned region: 845..890
Protein Sequence: 942 a.a.     [Download]
>gi|83718482|ref|YP_443208.1| Rhs element Vgr protein [Burkholderia thailandensis E264]
MSIPTDVLQALFGGWSQHDRFLWITTPLGANALVAESLHGWEALDQGGFRFQLTALAENPSLPLAQLIGA
PILIEWQAQEGRDARRPFHGHVIAAELVGYNGGLARVRLVVEPWLTLLRQRVDSYNYLNASVVEISEQVF
RRYARGAIAPAWRWALADAAKYPKRSLTAQAGESDFDFLERLWAEEGIFYWFEHEGDARASSLGKHTLVL
ADSNQRFAPDEPELVGFHQTSDDDPQGCIQHFMHARRWRIGSVARASWDHRSLSTRPTGARANGAVAPGE
DRDVAGPYAYQTGAIGDRRAQQQLDAQRVAALQSEGRGTRRDLRPGLRFAIAHHPTLGASDAFICLRVEH
SARANVDATVRSAIEQRLGAIASIADAAPAPYGPASALNAALGADTHHGGSLMQDDAVYRNRFVALPAEQ
AYRPLAASGHGARMHPVAVMPGAQTAIAVGAGDPVHTDRDHRIRIQHHAQRGRNAASREDHPHAANAPAD
RGAGTWTRMLTPVGGDNWGGVSVPRVGQEVWTEWLEGQPDRPVAVAALYNGRGNADAQHNAQAGGPSGST
GNAAAWFAGNTHAAVLTGFKTQDMSMSQQGTGGYRQFMLDDTAGQSSARLYTTDRNSGLTLGHMKQTQDN
QRQADRGYGAELATDGAGALRGGAGLLISTAPGVSQMDASAPSQVLAQHRQTLQSLAELAQKQGAEPGGA
VPEAASGAGATSTGAAAGKPLPAVDGIEQSREAIGATREGGGGDTAGGGSGSAVAWSKPHLVAHGEAGLA
AMSAKSHVWVSGTETVLSAGQDVQLTAKGKTSVVANHGVSLYTQGAAGDGRPVAGQGIALHAASGSVSVQ
AQNAGKLSASAQKAVTLASAQGSASVQAQQRVLLSAAKAYLKMEGNDIVVGAPGRADFKAAAHQLTGPKS
AGAQNALGKGASKDCPQTMGDMISSSAAFADL
-
Nucleotide Sequence: 2829 bp     [Download]
>gi|83718394|ref|NC_007651.1|:c3084173-3081345 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGTCGATCCCAACTGACGTTCTGCAAGCACTCTTCGGCGGCTGGTCGCAACACGACCGCTTTCTCTGGA
TCACGACGCCGCTCGGCGCGAACGCGCTCGTCGCGGAAAGCCTGCATGGCTGGGAGGCACTCGATCAGGG
GGGCTTTCGTTTTCAGCTCACCGCGCTCGCCGAGAATCCGTCGCTGCCGCTCGCGCAGTTGATCGGCGCG
CCGATCCTGATCGAATGGCAGGCGCAGGAAGGGCGCGACGCGCGCCGGCCGTTCCACGGCCACGTGATCG
CCGCCGAGCTCGTCGGCTACAACGGCGGCCTCGCACGCGTGCGGCTCGTCGTCGAGCCGTGGCTCACGCT
GCTGCGGCAGCGCGTCGACAGCTACAACTATCTGAACGCGAGCGTCGTCGAGATCAGCGAACAGGTGTTC
CGCCGTTACGCGCGCGGCGCGATCGCGCCCGCATGGCGATGGGCGCTCGCGGATGCGGCGAAGTACCCGA
AGCGCAGCCTGACCGCGCAAGCCGGCGAATCCGATTTCGACTTCCTCGAGCGCCTCTGGGCGGAGGAAGG
CATCTTCTACTGGTTCGAGCACGAAGGCGACGCGCGTGCGTCGAGCCTCGGCAAGCACACGCTCGTGCTC
GCCGATTCGAATCAGCGCTTCGCGCCCGACGAACCCGAGCTCGTCGGCTTCCATCAGACGAGCGACGACG
ATCCGCAAGGCTGCATCCAGCACTTCATGCACGCGCGGCGCTGGCGGATCGGCAGCGTCGCGCGCGCGAG
CTGGGATCACCGCAGCCTGTCGACGCGGCCGACGGGCGCGCGCGCGAACGGCGCGGTCGCGCCGGGCGAG
GACCGCGACGTCGCCGGCCCGTACGCATACCAGACTGGCGCGATCGGAGACCGGCGCGCGCAGCAGCAAC
TCGATGCGCAGCGCGTGGCCGCGCTGCAGAGCGAAGGCCGCGGCACGCGCCGCGATCTGCGGCCTGGGCT
GCGTTTTGCGATTGCGCATCATCCGACGCTCGGCGCATCGGATGCGTTCATCTGTCTGCGCGTCGAGCAT
TCGGCGCGCGCGAACGTCGATGCGACCGTGCGCAGCGCGATCGAACAGCGCCTCGGCGCGATTGCGTCGA
TCGCCGATGCCGCGCCGGCGCCGTATGGTCCCGCGAGCGCGCTGAATGCGGCGCTCGGCGCCGACACGCA
TCACGGCGGATCGCTGATGCAGGACGACGCTGTCTATCGCAATCGCTTCGTCGCGTTGCCCGCCGAGCAG
GCGTATCGGCCGCTCGCCGCGTCCGGCCATGGCGCGCGCATGCACCCGGTCGCCGTGATGCCGGGGGCGC
AGACGGCGATCGCCGTGGGCGCGGGCGATCCCGTTCACACCGACCGGGATCACCGGATTCGGATTCAGCA
TCACGCGCAGCGCGGCCGGAATGCCGCGAGCCGCGAAGATCATCCGCATGCGGCGAATGCGCCGGCGGAC
CGAGGCGCCGGCACGTGGACGCGCATGCTGACGCCCGTGGGCGGCGACAACTGGGGCGGCGTGAGCGTGC
CGCGCGTCGGGCAGGAAGTGTGGACTGAATGGCTCGAAGGCCAGCCCGACCGGCCGGTTGCGGTGGCCGC
GCTCTACAACGGCCGGGGCAATGCCGACGCGCAGCACAACGCGCAGGCGGGAGGCCCGAGCGGCAGTACC
GGCAATGCGGCCGCATGGTTTGCCGGCAATACGCACGCGGCGGTGCTCACGGGCTTCAAGACGCAGGACA
TGAGCATGAGCCAGCAGGGCACGGGCGGCTATCGGCAATTCATGCTCGACGATACGGCCGGCCAGTCGAG
CGCGCGTCTGTACACGACGGACCGCAACAGCGGGCTCACGCTCGGGCACATGAAGCAGACGCAGGACAAC
CAGCGCCAGGCCGATCGCGGCTATGGCGCGGAACTGGCGACGGATGGCGCCGGCGCACTGCGCGGCGGCG
CGGGGCTCTTGATCAGCACGGCGCCCGGCGTGAGTCAGATGGATGCGAGCGCGCCGAGCCAGGTGCTCGC
GCAGCATCGCCAGACGTTGCAAAGCCTCGCGGAGCTCGCGCAAAAGCAAGGCGCGGAGCCGGGCGGCGCG
GTGCCTGAGGCGGCGAGCGGAGCGGGCGCGACGTCGACGGGGGCGGCGGCGGGCAAGCCTTTGCCTGCAG
TCGACGGCATCGAGCAGAGCCGCGAAGCGATCGGCGCGACGCGAGAAGGAGGGGGCGGCGACACGGCGGG
CGGCGGGAGCGGCAGCGCGGTCGCGTGGAGCAAGCCGCATCTCGTCGCGCACGGCGAGGCGGGGCTGGCC
GCGATGTCGGCGAAGAGCCACGTGTGGGTGTCGGGTACCGAGACGGTGCTGAGCGCCGGACAGGACGTGC
AATTGACGGCGAAGGGCAAGACGAGCGTCGTCGCGAATCACGGCGTCTCGCTGTATACGCAGGGCGCGGC
GGGCGATGGGCGGCCGGTTGCCGGCCAGGGCATCGCGTTGCACGCGGCGTCCGGTTCGGTGAGCGTGCAG
GCGCAGAACGCCGGCAAGCTGAGCGCGAGCGCGCAGAAGGCGGTGACGCTCGCGAGCGCGCAGGGCAGCG
CGTCCGTGCAGGCGCAACAGCGCGTCCTGCTGAGCGCGGCGAAGGCGTATCTGAAGATGGAAGGCAACGA
CATCGTCGTCGGCGCGCCGGGGCGCGCGGATTTCAAGGCGGCGGCGCATCAGTTGACGGGGCCGAAGAGC
GCGGGGGCGCAGAACGCGTTGGGCAAGGGTGCTTCGAAGGATTGTCCGCAGACGATGGGCGACATGATTT
CGTCCAGCGCCGCATTCGCCGATCTATAA

Reference
(1) Russell AB et al. (2012). A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 11(5):538-49. [PudMed:22607806] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature