SecReT6
Effector Protein ID: 83718826
-
SecReT6 ID115
T6SS typeA4b
Gene symbol-
Locus tagBTH_I2705
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3097448..3100246 [-]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBTH_I2705
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ2SV29
KEGG IDbte:BTH_I2705
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 1.00E-43, Aligned region: 741..900
Phage_GPD [PF05954], Evalue: 3.00E-43, Aligned region: 37..356
Phage_GPD [PF05954], Evalue: 3.00E-43, Aligned region: 686..742
T6SS_Vgr [PF13296], Evalue: 2.20E-31, Aligned region: 579..687
Phage_base_V [PF04717], Evalue: 3.90E-17, Aligned region: 158..184
Phage_base_V [PF04717], Evalue: 3.90E-17, Aligned region: 423..520
Protein Sequence: 932 a.a.     [Download]
>gi|83718826|ref|YP_443220.1| Rhs element Vgr protein [Burkholderia thailandensis E264]
MSVVTQFTSLFSAANCLYSLDGAGEIASLQIERWVGRETLSDNFQWDVYALATDPGLDLDAMLGQRVTIR
TALADGTSAVRSGLVAQAECIGYDAGLARYYLQLVPWLAALAHGRDERTFVRQGIADVLGAVFAPYGAIA
RWRFTADANQRIAELGARDYRVQYRTHTHVDFVRHVLAEAGLGFCFVEDAEAPAGHAMLIFDDSAQLPED
DTSARMGGVPQRLSGTATEPDDAIVGIGQSLSLTADRVTLISSDYRGNQSTTATASLGSPAGSRELYDDV
GPEAFDSLREADDAARRHADAIISAARFWTGYSTLRTARVGRALRIAGATWRMPRGGAQAPDAFVLTRVD
QIGVNNLPATVMERIERGLGPLPLVNLDARVLAQAKAGGYANRFDAVPRDQAWRPTLEDGTGQRLNPVPT
ALGAQTAIVVGPQGESRPGSTGPVHTDAQGRLRLRYHWQADGDTGTYPTRAMQRLASQGHGLQQTQRIGH
EVLVQFVNGLVHRPIVLGGLFNGRGEGGEAPTPGGEAGQPLDESIYTQAADHVASAQGNLAGGHSPAWHG
AGGGAKRHNHAGALSGFKSQGFDGQGYNQLVADDTDRMGRMQMATTHAATQLNIGHLRHQADNYLGSFRG
QGVELRSDAYGALRGARGVLISSYAPTGPSQPAGDASALQSLLAQQATLAKLLDKSADTHKTLPFAAQRG
AEQAGQSSMNGDAAPLDALRKSFATTVGADGYAQASAEASSRSAGNALPHTGDAVLGIEAKGGHGLLAGQ
SLQWTVGETLTVGSGSDTNLAVSRTLRIHSGQGIGWLAGANGVQGVGMSVIAGKDDLTLQAQHDVMALRA
RDDLKVASIGADVEIAAKQTVRLAVSGGAHLTIEGGNVTFGCPGSLVVHAAQHTFVGPDQLAPALPQFPE
KVCVECLKHAMQSGSALAGKAI
-
Nucleotide Sequence: 2799 bp     [Download]
>gi|83718394|ref|NC_007651.1|:c3100246-3097448 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGAGCGTGGTCACGCAATTCACGTCGCTTTTCAGCGCTGCCAATTGTCTCTATTCCCTCGATGGGGCGG
GCGAAATCGCGTCGCTGCAGATCGAGCGCTGGGTGGGGCGCGAGACGCTCTCCGACAATTTCCAGTGGGA
CGTCTACGCGCTCGCGACCGATCCCGGTCTCGATCTCGACGCGATGCTCGGCCAGCGCGTGACGATTCGC
ACCGCACTCGCGGACGGCACGAGCGCGGTGCGCAGCGGGCTCGTGGCGCAAGCCGAGTGCATCGGCTACG
ACGCCGGCCTCGCGCGGTACTACCTGCAGCTCGTGCCGTGGCTCGCCGCGCTCGCGCACGGGCGCGACGA
GCGCACGTTCGTGCGGCAGGGCATCGCGGACGTGCTCGGCGCGGTGTTCGCGCCGTACGGCGCGATCGCC
CGCTGGCGCTTCACGGCGGACGCGAACCAGCGTATCGCGGAGCTCGGCGCGCGCGACTACCGCGTGCAGT
ACCGGACCCACACGCATGTCGATTTCGTTCGGCACGTGCTCGCCGAAGCGGGGCTCGGCTTTTGCTTCGT
CGAAGACGCGGAAGCGCCCGCCGGCCACGCGATGCTGATCTTCGACGACAGCGCGCAACTGCCCGAGGAC
GACACGTCCGCGCGCATGGGCGGCGTGCCGCAGCGGCTGAGCGGCACGGCGACGGAGCCGGACGACGCGA
TCGTCGGCATCGGGCAGTCGCTGTCGCTCACCGCGGATCGCGTCACGCTGATCAGCAGCGATTACCGCGG
CAATCAGTCGACGACTGCGACGGCGAGCCTCGGCAGCCCGGCCGGATCGCGCGAACTGTACGACGACGTC
GGGCCGGAGGCGTTCGACAGCCTGCGCGAAGCCGACGACGCCGCGCGCCGGCACGCGGACGCGATCATTT
CCGCGGCGCGCTTCTGGACGGGCTACAGCACGTTGCGCACCGCGCGCGTCGGCCGCGCGCTGCGCATCGC
GGGCGCGACGTGGCGCATGCCGCGCGGCGGCGCGCAGGCGCCCGACGCGTTCGTGCTGACGCGCGTCGAT
CAAATCGGCGTCAACAATCTGCCCGCGACCGTGATGGAACGCATCGAGCGCGGCCTCGGCCCGCTGCCGC
TCGTGAATCTCGATGCGCGCGTGCTCGCGCAGGCGAAGGCGGGTGGCTATGCGAACCGGTTCGATGCCGT
GCCGCGCGACCAGGCATGGCGCCCGACGCTGGAAGACGGCACCGGGCAGCGGCTGAACCCCGTGCCGACG
GCGCTCGGCGCGCAGACGGCGATCGTCGTCGGGCCGCAGGGCGAGTCGCGGCCGGGCTCGACGGGCCCGG
TGCACACCGATGCGCAGGGCAGACTGCGGCTGCGCTATCACTGGCAGGCGGACGGCGACACGGGCACCTA
TCCGACGCGCGCGATGCAGCGGCTCGCGAGCCAGGGCCATGGGCTGCAGCAGACACAGCGAATCGGCCAC
GAAGTGCTCGTGCAGTTCGTCAACGGCCTCGTGCACCGGCCGATCGTGCTCGGCGGGCTGTTCAACGGCC
GAGGCGAGGGCGGCGAAGCGCCGACGCCCGGCGGCGAAGCGGGGCAGCCGCTCGACGAATCGATTTACAC
GCAGGCCGCCGATCATGTGGCGAGCGCGCAAGGCAATCTCGCGGGCGGCCATAGCCCCGCATGGCACGGC
GCGGGCGGCGGCGCGAAGCGCCACAATCATGCGGGCGCGCTGTCCGGCTTCAAGAGCCAGGGGTTCGACG
GGCAGGGCTACAACCAACTCGTCGCGGACGATACCGATCGCATGGGCCGCATGCAGATGGCGACGACGCA
CGCGGCGACCCAGCTCAACATCGGCCACCTGCGCCATCAGGCCGACAACTATCTCGGCAGTTTTCGCGGG
CAAGGCGTCGAGCTGCGCTCGGACGCGTACGGCGCGCTGCGCGGCGCGCGCGGCGTGCTGATCTCCAGCT
ATGCGCCGACGGGGCCGTCGCAGCCGGCGGGCGACGCGTCGGCGCTGCAGTCGCTGCTCGCGCAACAGGC
GACGCTCGCGAAGCTCCTCGACAAATCGGCCGATACGCACAAGACCTTGCCGTTCGCCGCGCAGCGCGGC
GCGGAGCAGGCCGGGCAGTCCTCGATGAACGGCGACGCCGCGCCGCTCGACGCGCTCAGGAAGAGCTTCG
CGACGACGGTCGGCGCAGACGGCTACGCGCAGGCGTCTGCCGAGGCGTCGAGCCGCTCGGCGGGCAATGC
GCTGCCGCATACGGGCGACGCGGTGCTCGGGATCGAGGCGAAGGGCGGCCACGGTCTGCTGGCGGGCCAG
TCACTGCAATGGACGGTGGGCGAGACGCTGACCGTCGGCAGCGGCAGCGACACGAATCTCGCGGTCAGTC
GGACGCTGCGCATTCACAGCGGACAGGGCATCGGCTGGCTCGCCGGCGCGAACGGCGTGCAAGGCGTCGG
CATGAGCGTGATCGCCGGCAAGGACGATCTGACGCTGCAGGCGCAGCATGACGTGATGGCGCTGCGCGCG
CGCGACGATCTGAAGGTCGCGTCGATCGGCGCGGATGTCGAGATCGCGGCGAAGCAGACCGTGCGCCTCG
CGGTCAGCGGCGGCGCGCATCTGACGATCGAAGGCGGCAACGTCACGTTCGGCTGCCCGGGCTCGCTCGT
CGTCCACGCGGCGCAGCACACGTTCGTCGGGCCGGATCAACTGGCCCCCGCGCTGCCGCAGTTTCCCGAG
AAAGTGTGCGTCGAGTGCCTGAAGCACGCGATGCAATCGGGCAGCGCCCTCGCGGGCAAGGCGATCTGA

Reference
(1) Russell AB et al. (2012). A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 11(5):538-49. [PudMed:22607806] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature