SecReT6
Effector Protein ID: 83719397
-
SecReT6 ID115
T6SS typeA4b
Gene symbol-
Locus tagBTH_I2701
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3092917..3095325 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I2698
DescriptionTle1
UniProt IDQ2SV33
KEGG IDbte:BTH_I2701
PDB IDNA
Domain hit(s) vs Pfam DUF2235 [PF09994], Evalue: 1.70E-56, Aligned region: 42..144
DUF2235 [PF09994], Evalue: 1.70E-56, Aligned region: 260..281
DUF2235 [PF09994], Evalue: 1.70E-56, Aligned region: 285..409
Protein Sequence: 802 a.a.     [Download]
>gi|83719397|ref|YP_443216.1| hypothetical protein BTH_I2701 [Burkholderia thailandensis E264]
MSYRFASADRFDANFVTKDEQDAILRRLREDDAMTCCKTLHIGIFFDGTRNNADRDRSARKESNVARLHA
AFPIDQYHQAIYVAGVGTPFVEQIGDFGVGLQAAAGAAAGWAGEGRINWALLWIHDILHAYVHGQTLTAA
LGKSHEGLVKSMSLDMNFKGINLGGTSPKPGSIGDIKLRANSGVGALKLIAAEQNGVELTWDLDSNWAQL
KNELDSSKWNEAVQEWDTKRRKVLLDRRAQLKERIGDLLVKGKPKLQRIRLYVFGFSRGAAEARTFSNWL
ADALDPDFSLCGVPVSYDFLGIFDTVASVGIAQSAAATLFDGHGGWGRKELMAVPHYVRRCVHMVAAHEP
RGSFPLDLIDCSMDGREEIVYPGVHSDVGGGYGPGEQGRGRDDTDKLSQVPLLDMYREARKAGVPLDING
PGIGADVSASFKISAGLKQAFAAYVKKSENYYYEKDHGTPGLMRCHYGLYLRWRKMRLKDMHAQPSFKAA
QAGYPQDAADVGSANAELKEEWDDLLEVEKAGGPTITRYVKKFVTKWAGENPKTAAVVSTSLLPAAVAAE
VFVPGVSAATVLFGDKVVKLVQAQLMEKWEQWQQVRSDWNMGPPEPAISTLYDNYVHDSRAWFKPLGDDD
DVWNHKQIQELKTKQAGFERSHAAWKKRVEMGMPSPLQVTQAMGVGSTGLGPVGGLPPEPEPRSPLTAQQ
ADLLKRYDAAMQSAKQARAAKDPNAPTDSAVLTDPKVTGGLALQTSGREFYFLWGFLRWRTVFVNGVRWD
QPRVPTVQEEMEGMRMQMQRQVDMKGIGVLFQ
-
Nucleotide Sequence: 2409 bp     [Download]
>gi|83718394|ref|NC_007651.1|:c3095325-3092917 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGAGCTACCGTTTCGCATCCGCTGACCGATTCGATGCTAATTTCGTTACGAAAGACGAGCAGGACGCGA
TTTTGCGGAGGTTGCGTGAAGATGATGCTATGACTTGTTGTAAGACATTGCATATCGGAATTTTCTTCGA
TGGTACGCGTAACAATGCTGATCGTGATAGGAGCGCGCGAAAGGAAAGCAATGTGGCACGGCTTCACGCC
GCGTTCCCAATAGATCAATATCACCAAGCGATTTACGTTGCTGGAGTCGGTACGCCTTTTGTTGAGCAGA
TTGGTGATTTCGGTGTTGGCCTACAGGCGGCCGCAGGGGCTGCGGCAGGTTGGGCGGGGGAAGGGCGAAT
TAACTGGGCGCTACTTTGGATTCACGATATTTTGCATGCGTATGTTCACGGTCAGACGTTAACGGCGGCG
TTAGGAAAGAGCCACGAGGGACTCGTAAAGTCGATGAGCCTCGATATGAATTTTAAGGGCATCAACCTTG
GCGGAACGTCGCCTAAGCCGGGAAGCATCGGCGATATCAAATTGCGTGCCAATTCTGGTGTGGGGGCGCT
CAAGCTGATTGCTGCCGAACAGAATGGTGTCGAGCTGACTTGGGATTTAGATTCGAATTGGGCGCAGCTC
AAAAACGAGTTGGATTCGTCGAAGTGGAATGAGGCAGTGCAAGAATGGGACACCAAGCGCCGCAAGGTAT
TGCTCGATCGTCGTGCCCAGTTAAAAGAGCGTATCGGTGATCTGCTGGTCAAGGGAAAACCGAAGCTGCA
ACGCATTCGGCTATACGTATTCGGATTTTCGCGCGGCGCAGCGGAGGCTCGCACTTTCTCGAACTGGCTT
GCTGACGCGCTCGATCCCGATTTCAGTTTGTGCGGAGTGCCGGTTTCATACGATTTTCTCGGCATTTTTG
ATACGGTCGCATCGGTCGGTATCGCCCAGAGCGCCGCCGCAACGTTATTCGATGGACATGGAGGATGGGG
GCGCAAGGAGTTGATGGCCGTGCCGCATTATGTGCGGCGTTGCGTGCACATGGTGGCGGCACATGAACCT
CGTGGATCATTTCCGCTCGATCTTATCGATTGTTCGATGGACGGTCGTGAGGAGATTGTCTACCCGGGTG
TTCACTCGGACGTCGGCGGCGGCTATGGGCCGGGCGAACAGGGGCGCGGTCGGGACGATACCGACAAACT
TTCGCAAGTCCCGCTGCTTGATATGTACCGGGAAGCGCGTAAGGCAGGGGTGCCGTTGGATATCAACGGG
CCGGGTATCGGCGCGGACGTCAGCGCTTCATTTAAGATTTCAGCAGGACTAAAGCAAGCTTTCGCCGCCT
ACGTAAAAAAAAGTGAGAACTATTATTACGAGAAAGATCACGGCACGCCGGGCCTAATGCGTTGCCATTA
CGGCTTGTATCTTCGGTGGCGCAAGATGCGGCTCAAGGACATGCATGCACAGCCAAGCTTCAAGGCTGCG
CAGGCAGGCTATCCGCAAGATGCAGCGGATGTGGGCAGTGCGAACGCGGAGTTGAAGGAGGAGTGGGACG
ATCTGCTGGAGGTCGAGAAGGCTGGTGGCCCGACAATCACCCGATATGTAAAGAAGTTTGTTACGAAATG
GGCCGGCGAGAATCCGAAAACGGCCGCCGTCGTCTCCACGTCTCTACTTCCGGCCGCGGTCGCTGCTGAA
GTTTTTGTTCCGGGCGTTAGCGCTGCGACGGTTCTATTTGGCGACAAAGTGGTGAAACTGGTACAAGCCC
AACTCATGGAGAAGTGGGAGCAGTGGCAACAAGTTCGCAGCGACTGGAACATGGGGCCGCCTGAACCTGC
GATCAGCACGCTCTACGACAACTACGTGCACGACTCCCGCGCATGGTTCAAGCCGCTCGGCGACGATGAC
GACGTGTGGAACCATAAGCAGATTCAGGAACTCAAGACCAAGCAAGCTGGCTTTGAACGCTCCCATGCGG
CCTGGAAAAAGCGTGTCGAAATGGGCATGCCGAGCCCGTTGCAGGTTACACAGGCAATGGGCGTAGGTTC
CACAGGATTGGGGCCCGTCGGCGGGCTTCCGCCCGAACCCGAACCCCGCTCCCCACTCACCGCCCAGCAA
GCCGATTTGCTCAAGCGCTACGACGCCGCGATGCAGTCCGCGAAGCAGGCGCGCGCCGCGAAGGACCCGA
ACGCGCCGACGGACAGCGCCGTGCTCACCGATCCGAAAGTGACGGGCGGCCTCGCGTTGCAAACCAGCGG
CCGCGAGTTCTATTTCCTGTGGGGCTTCCTGCGCTGGCGAACCGTGTTCGTGAACGGCGTGCGCTGGGAC
CAGCCGCGCGTGCCGACAGTGCAAGAGGAAATGGAGGGCATGCGCATGCAGATGCAACGCCAGGTCGACA
TGAAGGGCATCGGCGTACTGTTCCAATGA