SecReT6
Effector Protein ID: 83720129
-
SecReT6 ID115
T6SS typeA4b
Gene symbol-
Locus tagBTH_I2697
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3085793..3089128 [-]
ProductRhs element Vgr protein
Effector typeProtein
Homologous effectorBTH_I2697
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ2SV37
KEGG IDbte:BTH_I2697
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-51, Aligned region: 35..340
Phage_GPD [PF05954], Evalue: 1.20E-51, Aligned region: 668..769
DUF2345 [PF10106], Evalue: 2.00E-48, Aligned region: 573..624
DUF2345 [PF10106], Evalue: 2.00E-48, Aligned region: 667..820
T6SS_Vgr [PF13296], Evalue: 1.20E-30, Aligned region: 516..623
T6SS_Vgr [PF13296], Evalue: 1.20E-30, Aligned region: 693..720
Phage_base_V [PF04717], Evalue: 2.00E-15, Aligned region: 384..497
Phage_base_V [PF04717], Evalue: 2.00E-15, Aligned region: 574..589
Protein Sequence: 1111 a.a.     [Download]
>gi|83720129|ref|YP_443212.1| Rhs element Vgr protein [Burkholderia thailandensis E264]
MDLVAALTGYSQTTRHIRIDTAMPGAFVVERFHGREGVNESFRFEIDVLSSEPFLDLTPLIGHAARLRLA
TGAGERSWNGYVTHAAYADSDGEITRYRITMESWLALLRLRRNCLYFVDVDTKDICERVFGDYPEARRRY
ELTEPLRNFSLRGQYRETDDAFVLRQLAEAGLSFRIEHAQDAGKEASGDHTVAVFDRRAEFPRGSTIAYN
LQDVGDPDGVITQFSERHQMVPDRVVATSWKADELLALAGHAQQQPDDKAPVLPVREIYDGQRAGRFDTI
DDAQRFAEQRLDALRLPKRVHYGAGSSRTLEIGKVHTLAGYLDGAITFVPLSIEHEAVNNLGADIGALLG
RGELDKGLYRNRFVAVPEGTPIVPLHRDRPIVHGVQTAIVVGEPGSRVSSTRDHQVRVQFPWMRGAAPLP
GGLTDTASRSNPAGHAPGDHRSGVLVRVAESSAGPNFGHAFTPRVGAEVVIGFESGNIDMPVVLGQVYGG
RVQPPFAAGEGSDANHPGTLTGLQTQTLDGQSGSRWVMDDAAGQLRHELSNSTANSRLAQGYLIDQQGST
RGAYRGEGFELATQGWGVVRAGEGVLVSSTARRLATSTQMDVAESVGQLKQAVRTAQGMSESAAAAHAGG
LAANAAQADFLKAIDPAQDGKYTGAVNGQSATKSSGAQRDGGEPVERFAAPAVLMESPENIVLTTPHSAV
SYAAQHVHLTAQRDAHVAAAATVAAASGDAVSLYAAAGGLRAIASDGPVSVEAHTSAMEILADQSVRITS
TDDRIDVLAKDAIVLQQGPNRITLKGGDITVETPGQFLVKSGAHPFPGPAAQSVSLPPLPVPAPLALFDE
QIRFVNENGEPLGNVAYKLKLADGSTVSGVTDDNGRTERVSTDGPTAIQSATLTPTQVVDCCGRTSDVPP
PAVKVDIKGIGTNDTLVGSSEKSVTVKGESRPLTEGEIEMAKTVFQDSIDYSAVRVHKGSYFWFNLQSKH
TAVTPNNTMYFREEDFVEDFSIVSEEYPRRGWFMHEMTHVWQHQRGYAVRWHALTVTIRGESAYRYEIEP
GQVFSDFNMEQQGNLVSDYFALIVVDNRAELIHAQPGSKNQLRQVLAPLLQDPKDASNLPK
-
Nucleotide Sequence: 3336 bp     [Download]
>gi|83718394|ref|NC_007651.1|:c3089128-3085793 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGGATTTAGTCGCCGCATTGACGGGCTATTCTCAAACCACCCGCCACATCCGGATCGACACTGCGATGC
CGGGCGCGTTCGTGGTCGAACGTTTCCATGGGCGCGAGGGCGTCAACGAATCGTTCCGCTTCGAGATCGA
CGTGCTGTCGAGCGAGCCGTTTCTCGATCTGACGCCGCTCATCGGCCACGCGGCGCGGCTGCGTCTCGCG
ACGGGGGCGGGCGAACGGAGCTGGAACGGCTACGTGACGCACGCGGCCTACGCGGACAGCGACGGCGAGA
TCACTCGCTATCGCATCACGATGGAGTCGTGGCTCGCGCTGCTGCGCCTGCGCCGCAATTGCCTGTATTT
CGTCGACGTCGACACGAAGGACATCTGCGAGCGTGTGTTCGGCGACTATCCGGAAGCGCGCCGGCGCTAC
GAGCTGACGGAGCCGTTGCGCAACTTCAGCCTGCGCGGCCAGTACCGGGAGACCGACGACGCGTTCGTGT
TGCGCCAGCTTGCCGAAGCCGGCCTGTCGTTCAGGATCGAGCATGCGCAGGATGCAGGCAAGGAAGCGTC
GGGCGATCACACGGTCGCCGTGTTCGATCGTCGCGCGGAATTTCCGCGCGGCAGCACGATCGCGTACAAC
CTGCAGGACGTCGGCGATCCGGACGGCGTGATCACGCAATTCTCCGAACGCCATCAGATGGTGCCGGACC
GGGTCGTCGCGACGAGCTGGAAGGCGGACGAATTGCTCGCGCTCGCGGGGCACGCGCAGCAGCAGCCTGA
CGACAAGGCGCCCGTGCTGCCCGTGCGCGAAATCTACGACGGCCAGCGCGCGGGCCGCTTCGATACGATC
GACGACGCGCAGCGCTTCGCCGAGCAGCGGCTCGACGCGCTGCGCCTGCCGAAGCGGGTCCACTATGGCG
CGGGCTCGTCGCGCACGCTCGAGATCGGCAAGGTCCATACGCTCGCCGGTTATCTGGACGGTGCGATCAC
GTTCGTGCCGCTGTCAATCGAGCACGAGGCGGTCAACAATCTCGGCGCCGACATCGGCGCGCTGCTCGGG
CGCGGCGAGCTCGACAAGGGGCTGTACCGCAACCGCTTCGTCGCGGTACCCGAGGGCACGCCGATCGTGC
CGTTGCATCGCGATCGGCCGATCGTGCACGGCGTGCAGACCGCGATCGTCGTCGGCGAGCCCGGCAGCCG
CGTCAGCAGCACGCGCGATCATCAGGTGCGCGTGCAGTTTCCGTGGATGCGCGGCGCAGCTCCGCTGCCC
GGCGGCCTGACCGACACGGCGAGCCGCTCGAATCCGGCCGGGCACGCGCCGGGCGATCATCGCTCGGGCG
TGCTCGTGCGCGTTGCCGAATCGTCGGCCGGGCCGAATTTCGGGCATGCGTTCACGCCGCGCGTCGGCGC
GGAAGTGGTGATCGGCTTCGAGTCGGGCAACATCGACATGCCCGTCGTGCTCGGCCAGGTCTACGGCGGG
CGCGTGCAGCCGCCGTTCGCGGCGGGCGAAGGCAGCGACGCGAACCATCCGGGCACGCTGACCGGCCTGC
AGACACAAACGCTCGATGGCCAGTCCGGCAGCCGCTGGGTGATGGACGACGCTGCGGGACAACTGCGGCA
CGAACTGAGCAACTCGACCGCGAACAGCCGGCTCGCGCAGGGTTATCTGATCGATCAGCAGGGCTCGACG
CGCGGCGCGTATCGCGGCGAAGGCTTCGAGCTTGCGACCCAGGGATGGGGCGTCGTGCGTGCGGGCGAAG
GCGTGCTCGTATCGAGCACCGCGCGGCGGCTCGCGACGTCGACGCAGATGGATGTCGCGGAAAGCGTCGG
ACAACTGAAGCAGGCGGTGCGGACCGCGCAGGGCATGAGCGAATCCGCCGCCGCGGCGCATGCGGGCGGG
TTGGCCGCCAATGCCGCGCAGGCGGATTTCCTGAAGGCGATCGATCCGGCGCAGGACGGCAAGTACACGG
GCGCGGTCAACGGGCAGAGCGCGACGAAGTCGAGCGGCGCCCAGCGTGACGGCGGCGAGCCGGTCGAGCG
CTTCGCCGCGCCGGCGGTGCTGATGGAGTCGCCGGAGAACATCGTGTTGACGACGCCGCACAGCGCCGTA
TCGTATGCGGCGCAGCACGTGCATTTGACCGCGCAGCGCGATGCGCACGTGGCGGCCGCCGCGACGGTCG
CGGCCGCGTCAGGCGATGCGGTGAGCCTGTACGCCGCCGCGGGCGGCCTCAGGGCAATCGCGAGCGACGG
GCCGGTGAGCGTCGAGGCGCATACGTCGGCGATGGAGATTCTCGCGGATCAGTCGGTGCGCATCACGTCG
ACCGACGATCGCATCGACGTGCTCGCGAAGGACGCAATCGTGCTGCAGCAGGGGCCGAACCGGATCACGC
TGAAGGGCGGCGACATCACGGTCGAGACGCCGGGGCAGTTCCTCGTGAAGTCGGGCGCGCATCCGTTTCC
GGGGCCGGCGGCGCAGAGCGTTTCGCTGCCGCCGCTGCCGGTTCCCGCGCCGCTCGCGCTGTTCGACGAA
CAGATTCGCTTCGTCAACGAAAACGGCGAGCCGCTCGGCAACGTCGCGTACAAGCTGAAGCTTGCCGATG
GCTCGACCGTGTCGGGCGTGACCGACGACAACGGGAGAACCGAGCGCGTGTCGACGGACGGGCCGACGGC
GATCCAGTCGGCGACGCTCACGCCGACGCAGGTCGTCGACTGCTGCGGGCGAACGTCGGATGTGCCGCCG
CCGGCGGTGAAGGTCGACATCAAGGGCATCGGCACCAACGACACGCTGGTGGGCAGCTCGGAGAAATCGG
TCACGGTCAAGGGTGAGAGCCGGCCGCTGACTGAAGGCGAGATCGAGATGGCGAAAACCGTGTTTCAGGA
CAGCATCGATTACAGCGCGGTGCGCGTGCACAAGGGCAGCTATTTCTGGTTCAACTTGCAGAGCAAGCAT
ACGGCCGTGACGCCGAACAATACGATGTATTTCCGCGAAGAGGATTTCGTGGAGGACTTTTCGATTGTCA
GCGAGGAGTATCCGAGGCGGGGTTGGTTCATGCACGAAATGACGCACGTTTGGCAACATCAACGAGGATA
TGCCGTACGCTGGCATGCGCTCACCGTGACGATTCGCGGCGAGAGCGCGTATCGGTACGAAATCGAGCCC
GGGCAAGTCTTCAGCGACTTCAATATGGAGCAGCAAGGCAATCTTGTATCAGACTACTTTGCGCTCATTG
TCGTGGACAATCGAGCTGAATTGATTCATGCGCAACCAGGAAGCAAGAATCAACTTCGCCAAGTGCTGGC
CCCACTTCTACAGGATCCCAAGGATGCATCGAATCTTCCGAAATAG

Reference
(1) Russell AB et al. (2012). A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 11(5):538-49. [PudMed:22607806] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature