SecReT6
Effector Protein ID: 83720828
-
SecReT6 ID115
T6SS typeA4b
Gene symbol-
Locus tagBTH_I0068
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]73967..74407 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I0068 (Tae2)
DescriptionTae2; amidase
UniProt IDQ2T2K7
KEGG IDbte:BTH_I0068
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 0.0043, Aligned region: 45..123
Protein Sequence: 146 a.a.     [Download]
>gi|83720828|ref|YP_440628.1| hypothetical protein BTH_I0068 [Burkholderia thailandensis E264]
MPYVSTHYSNNAGAPVGRWTCAPTSKLAPFDKAPTGSVTSGVDLCGQCVSYVKRVCPTLPLTGQWRKGAP
VKGNATIVAGTVIATFNAAGKYDGHAAIYVSQTKDGGILVYDQFVTPPTPQPVQQRRLRWGAHGRSNNGD
NFYVVE
-
Nucleotide Sequence: 441 bp     [Download]
>gi|83718394|ref|NC_007651.1|:73967-74407 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGCCTTACGTGTCGACTCATTACTCGAACAACGCCGGCGCGCCGGTCGGCCGCTGGACCTGCGCGCCGA
CTTCGAAGCTCGCGCCTTTCGACAAGGCGCCGACGGGCAGCGTCACGTCCGGCGTCGATCTGTGCGGCCA
ATGCGTGTCCTACGTGAAACGGGTCTGCCCGACGCTGCCGCTCACCGGGCAATGGCGCAAGGGCGCGCCG
GTGAAAGGCAACGCGACGATCGTCGCGGGCACCGTGATCGCGACGTTCAACGCCGCCGGCAAGTACGACG
GCCATGCGGCGATCTACGTCAGCCAGACGAAGGACGGCGGCATCCTGGTGTACGACCAGTTCGTGACGCC
GCCGACGCCGCAGCCGGTGCAGCAACGGCGCCTGCGCTGGGGCGCGCATGGCCGGTCGAACAATGGGGAC
AACTTCTATGTCGTGGAGTAA

Reference
(1) Russell AB et al. (2012). A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 11(5):538-49. [PudMed:22607806] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature