SecReT6
Effector Protein ID: 83721061
-
SecReT6 ID115
T6SS typeA4b
Gene symbol-
Locus tagBTH_I2698
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3089237..3091639 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I2698 (Tle1)
DescriptionTle1; Lipase
UniProt IDQ2SV36
KEGG IDbte:BTH_I2698
PDB IDNA
Domain hit(s) vs Pfam DUF2235 [PF09994], Evalue: 7.40E-52, Aligned region: 42..126
DUF2235 [PF09994], Evalue: 7.40E-52, Aligned region: 260..280
DUF2235 [PF09994], Evalue: 7.40E-52, Aligned region: 283..409
Protein Sequence: 800 a.a.     [Download]
>gi|83721061|ref|YP_443213.1| hypothetical protein BTH_I2698 [Burkholderia thailandensis E264]
MNFRFAPAERPDIGVVTKEEKDAILRRLHDDDGMSCCKTLHIGIFFDGTRNNAERDKSGHKHSNVARLRD
AFPQDRYHKSIYVAGVGTPFSSEIGDYGIGLQAVAGASAGWAGEGRINWALLQIHNAVHECAFRVGLSTA
LGVDDKNLVKLMSLDMNFKGIDLGGNAPQPGSTGDIKSRSSPGIGALKLIAAEQYGAELTWDKDTNWSQL
KDDLDSSKWAAAVRAWDGRRRKILGDRRAQLKARVGDMLVKGKPRIQRIRLYVFGFSRGAAEARTFSNWL
VDALESDFSLCGVPVSYDFLGIFDTVASVGIAQSAAATLFDGHGGWARKELMAVPHYVRRCVHMVAAHEP
RGSFPLDLIDCSLEGREEIVYPGVHSDVGGGYGPAEQGRGRGDADKLSQVPLVDMYRAARIAGVPLDIQG
PGITSEAADVFKISAGLKQAFTAYVKASEGYYYAKEHGTAGLMRAHYGLYLRWRRMRLKDMSLQPSFKAA
QANCPQDAMDIDSANKELRAEWEDLLEIEKEGGPSVAHYAKKFGAKVARDNPKIVASVSAVLLPGVIVFS
TRPEVIYGVRKAGDRVTELVRAQLQEKWEQWQQVRSDWNMGPPEAPISALYDNYMHDSRAWFKPLGDDDD
VWNYKQIQELKSKQASFEREHAAWRKRAETGAPGPWQIAQAMSAGASGLGPIAMQPEPEPRSPLTAQQAD
LLKRYDAAMQSAKQARAAKDPNAPTDSAVLTDPKVTGGLALQTSGREFYFLWGFLRWRTVFVNGVRWDQP
RVPTVQEEMEGMRMQMQRQVDMKGIGVLFQ
-
Nucleotide Sequence: 2403 bp     [Download]
>gi|83718394|ref|NC_007651.1|:c3091639-3089237 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGAATTTTCGCTTTGCTCCGGCCGAACGCCCCGACATAGGCGTTGTGACGAAAGAAGAAAAGGACGCGA
TTCTTCGGCGGCTTCATGACGACGATGGTATGAGTTGTTGTAAAACTCTTCACATCGGAATTTTCTTCGA
CGGTACGCGTAACAACGCGGAAAGGGACAAGTCAGGGCATAAGCACAGTAACGTGGCTCGCCTTCGGGAC
GCGTTTCCTCAAGATCGATATCACAAGTCCATTTACGTCGCTGGGGTAGGGACACCTTTCTCAAGCGAAA
TCGGTGATTATGGTATCGGACTTCAAGCCGTGGCTGGCGCATCTGCCGGATGGGCTGGCGAAGGACGTAT
TAACTGGGCCTTATTGCAAATCCATAATGCAGTGCACGAATGTGCTTTCCGTGTTGGTCTTAGTACCGCG
CTCGGGGTGGACGACAAGAATTTGGTGAAGTTGATGAGCCTAGACATGAACTTCAAGGGCATCGACCTGG
GTGGAAATGCTCCCCAACCTGGTAGTACAGGTGACATTAAATCGCGATCGAGCCCTGGCATCGGTGCGCT
CAAGTTGATCGCGGCCGAACAGTACGGCGCGGAGTTGACGTGGGACAAGGATACGAACTGGTCCCAGTTA
AAGGATGATCTGGATTCGTCGAAATGGGCGGCGGCTGTGCGGGCGTGGGACGGTAGACGCCGCAAGATTT
TGGGCGATCGTCGTGCGCAGTTGAAGGCGCGGGTCGGCGACATGCTTGTTAAGGGCAAGCCGAGAATCCA
GCGCATTCGCCTTTATGTGTTTGGATTTTCGCGGGGTGCAGCGGAAGCTCGCACGTTTTCGAATTGGCTT
GTCGATGCACTCGAATCCGATTTCAGCCTGTGTGGTGTTCCCGTCTCGTACGATTTCCTTGGAATTTTCG
ATACTGTCGCGTCAGTCGGCATTGCGCAGAGCGCCGCCGCGACACTTTTCGATGGGCACGGCGGTTGGGC
GCGTAAGGAATTAATGGCGGTGCCGCACTATGTCCGCCGCTGCGTGCATATGGTCGCTGCGCATGAGCCG
CGCGGCTCGTTTCCGCTCGATCTGATCGACTGTTCGTTGGAAGGGCGAGAGGAAATTGTGTATCCCGGCG
TTCACTCAGATGTGGGGGGTGGTTACGGACCAGCCGAGCAGGGACGAGGACGAGGCGATGCCGATAAGTT
GTCGCAAGTTCCACTCGTTGACATGTATAGAGCGGCACGTATCGCCGGCGTACCGCTCGATATACAAGGA
CCGGGCATCACGTCGGAAGCGGCCGATGTATTTAAGATCTCCGCTGGACTCAAGCAAGCCTTTACTGCCT
ATGTCAAGGCAAGTGAGGGCTACTATTACGCGAAGGAGCATGGGACAGCGGGTTTGATGCGAGCTCATTA
TGGTTTGTATCTGCGCTGGCGCAGGATGCGTCTCAAGGATATGAGCTTGCAGCCGAGTTTCAAGGCTGCG
CAGGCGAATTGTCCGCAAGACGCTATGGATATCGACAGTGCGAATAAGGAATTAAGGGCGGAATGGGAAG
ATCTGCTGGAGATTGAAAAGGAGGGAGGCCCGAGTGTGGCCCATTATGCAAAGAAGTTTGGAGCGAAAGT
GGCTCGAGACAATCCTAAAATTGTCGCATCCGTCTCGGCCGTTCTTTTGCCGGGGGTCATCGTCTTCAGT
ACTCGTCCTGAAGTTATTTACGGGGTGAGAAAGGCCGGTGATCGCGTGACAGAACTAGTCCGCGCCCAGC
TTCAAGAAAAATGGGAGCAATGGCAGCAAGTCCGCAGCGACTGGAACATGGGCCCGCCCGAAGCGCCGAT
CAGCGCGCTGTACGACAACTACATGCACGACTCGCGAGCATGGTTCAAGCCGCTCGGCGATGACGACGAC
GTCTGGAACTACAAGCAGATCCAGGAGCTGAAGTCGAAGCAAGCGAGCTTCGAGCGCGAGCACGCCGCAT
GGAGAAAACGCGCCGAAACGGGCGCGCCGGGGCCGTGGCAGATCGCGCAGGCGATGAGTGCGGGGGCGTC
CGGACTCGGGCCGATCGCAATGCAGCCCGAACCCGAACCCCGCTCCCCGCTCACCGCCCAGCAAGCCGAT
TTGCTCAAGCGCTACGACGCCGCGATGCAGTCCGCGAAGCAGGCGCGCGCCGCGAAGGACCCGAACGCGC
CGACGGACAGCGCCGTGCTCACCGATCCGAAAGTGACGGGCGGCCTCGCGTTGCAAACCAGCGGCCGCGA
GTTCTATTTCCTGTGGGGCTTCCTGCGCTGGCGAACCGTGTTCGTGAACGGCGTGCGCTGGGACCAGCCG
CGCGTGCCGACAGTGCAGGAGGAAATGGAGGGCATGCGCATGCAGATGCAACGCCAGGTCGACATGAAGG
GCATCGGCGTACTGTTCCAATGA

Reference
(1) Russell AB et al. (2013). Diverse type VI secretion phospholipases are functionally plastic antibacterial effectors. Nature. 496(7446):508-12. [PudMed:23552891] experimental
(2) Russell AB et al. (2012). A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 11(5):538-49. [PudMed:22607806] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature