SecReT6
Effector Protein ID: 83721528
-
SecReT6 ID115
T6SS typeA4b
Gene symbol-
Locus tagBTH_I1830
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]2056900..2057424 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_I1830
Description
UniProt IDQ2SXI7
KEGG IDbte:BTH_I1830
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 174 a.a.     [Download]
>gi|83721528|ref|YP_442362.1| hypothetical protein BTH_I1830 [Burkholderia thailandensis E264]
MASCPGFQIQKSEGNQMSMACTGTAFYQAFKQNMEALGLDVPSSWYGTQTALLTRVGALVAAVDRLGKDA
TLAELIGATTLPEKLLAAGGIYASWYVGAAVGSLMVATGKFTQCSSSTDISRAVQRFQFEAAIRVPSSLL
FHLQTHPEIFDDNATNRLMYARRGLSTKQPEFAK
-
Nucleotide Sequence: 525 bp     [Download]
>gi|83718394|ref|NC_007651.1|:c2057424-2056900 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGGCATCCTGCCCGGGCTTTCAAATACAGAAATCCGAGGGAAATCAAATGTCTATGGCCTGCACGGGAA
CAGCGTTCTACCAAGCCTTCAAGCAAAACATGGAAGCGCTAGGGCTCGATGTGCCGTCGAGCTGGTACGG
CACCCAAACCGCCCTGCTTACACGCGTCGGCGCACTCGTCGCAGCTGTCGACCGGCTCGGCAAGGATGCA
ACGCTTGCGGAACTGATCGGCGCAACGACTTTGCCTGAGAAACTGCTAGCGGCCGGCGGAATCTATGCAT
CGTGGTATGTCGGCGCGGCCGTCGGTAGCCTCATGGTCGCCACCGGCAAATTTACGCAGTGCAGCAGCTC
GACTGACATCTCACGAGCCGTCCAACGATTCCAGTTCGAGGCGGCGATCCGTGTTCCGAGCAGCCTGCTG
TTTCACCTGCAGACGCACCCGGAAATCTTCGATGACAACGCAACGAACCGCCTCATGTATGCGCGCCGCG
GCCTGTCGACAAAGCAACCCGAATTCGCGAAATGA

Reference
(1) Russell AB et al. (2012). A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 11(5):538-49. [PudMed:22607806] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature