SecReT6
Effector Protein ID: 91188895
-
SecReT6 ID939
T6SS type
Gene symbol-
Locus tagV12G01_16147
StrainVibrio alginolyticus 12G01
RepliconT6SS [GenBank: AAPS01000023] [Browse all T6SS(s) in this replicon]
Location [Strand]47313..48257 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorV12G01_16147
DescriptionImmunity protein of V12G01_16152.
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 314 a.a.     [Download]
>gi|91188895|ref|EAS75180.1| hypothetical protein [Vibrio alginolyticus 12G01]
MAYLPFYITPEEFSAYQEEQEQKILNGMNLTVWHKHDIEEPFRYLYLSIAIAAVSPLFFLTYFLHDSSEM
ILTYILSGLTIIMSGVSYLTFGLDNRYDYTFSDRGLVIKKRRNLPNWVNSAAQVMGWIGAIVCVVMVGVA
GPMVLVGAGGFILVSFGMLKRQPDEPTEVRVGEREDWLFADYNKKRKVIKFFFKHDTCEYINIEHTKISR
LHNRFHYYVFFKTVSDLESMVNQLATEYKLDCTEVADHKKLFEAKPEARLFGTPVCYKEYQTDEVFDLRA
SNAPLPEREYLYNGKWQTESEIEQSKSELTAAKV
-
Nucleotide Sequence: 945 bp     [Download]
>gi|91188851|ref|AAPS01000023.1|:c48257-47313 Vibrio alginolyticus 12G01 1100007009686, whole genome shotgun sequence
TTGGCTTATTTACCTTTCTATATTACCCCAGAAGAATTTTCAGCATACCAAGAAGAGCAGGAGCAAAAAA
TTCTTAACGGGATGAATCTGACAGTCTGGCATAAGCACGATATTGAAGAGCCTTTTCGATACTTATACCT
ATCAATTGCTATAGCTGCTGTCAGTCCATTATTTTTCCTTACCTATTTCCTACATGATAGTAGTGAAATG
ATCTTAACTTACATTTTATCGGGGCTGACGATAATCATGTCTGGTGTGTCTTATCTGACATTTGGTTTGG
ACAATCGGTATGATTACACCTTCTCCGATCGCGGGTTAGTCATAAAAAAACGACGTAATTTACCGAATTG
GGTAAACTCCGCGGCTCAAGTCATGGGCTGGATTGGAGCAATAGTTTGTGTCGTGATGGTTGGAGTTGCT
GGACCGATGGTTCTTGTCGGAGCCGGTGGCTTTATATTGGTTTCATTTGGTATGCTTAAACGTCAGCCTG
ATGAACCAACAGAAGTGAGGGTCGGAGAACGTGAAGACTGGCTCTTTGCTGATTACAATAAGAAAAGAAA
AGTAATTAAGTTCTTTTTTAAGCATGACACATGCGAATATATTAATATAGAACATACTAAGATTTCACGC
TTACACAACCGATTCCACTATTACGTATTTTTCAAAACCGTGTCTGACTTAGAGTCTATGGTCAATCAGC
TAGCCACGGAATATAAGCTTGACTGTACAGAAGTCGCCGACCACAAAAAGCTATTTGAAGCTAAGCCAGA
GGCTAGACTGTTTGGTACGCCAGTTTGTTATAAAGAATATCAAACCGATGAGGTATTTGATTTAAGGGCG
TCAAATGCCCCGCTCCCAGAGCGAGAGTACCTATATAACGGCAAGTGGCAAACCGAGTCTGAAATCGAAC
AATCAAAATCTGAACTAACGGCAGCCAAGGTATAA

Reference
(1) Salomon D et al. (2015). Type VI Secretion System Toxins Horizontally Shared between Marine Bacteria. PLoS Pathog. 11(8):e1005128. [PudMed:26305100] experimental
 
experimental experimental literature