SecReT6
Effector Protein ID: 91190359
-
SecReT6 ID939
T6SS type
Gene symbol-
Locus tagV12G01_01430
StrainVibrio alginolyticus 12G01
RepliconT6SS [GenBank: AAPS01000007] [Browse all T6SS(s) in this replicon]
Location [Strand]97561..98319 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorV12G01_01430
DescriptionImmunity protein of V12G01_01435.
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 252 a.a.     [Download]
>gi|91190359|ref|EAS76628.1| hypothetical protein [Vibrio alginolyticus 12G01]
MNKMITFSLIFLSTYSFAESSITQEQKFTEAEGPFCQYSLKANGTSYDFSFFDSCGTSDLIKLNEELYLV
DLTNGNINSEAYFIFDTEKKEVPKEIGSLNLSYDIYDYGFDIIDHTLLDRDNGKIIKNANNNYTGVLSYI
FQRDNFNMNIPKDRILYWNRNGEENYCSSTIVFSANYDEHRRDVCWNSFSSRYEYVEIIEGRVSLRIKGE
FDGRQFKFDNNGEELTINPYNGKYSTNKTNEKFPDEDYFNIK
-
Nucleotide Sequence: 759 bp     [Download]
>gi|91190267|ref|AAPS01000007.1|:c98319-97561 Vibrio alginolyticus 12G01 1100007009655, whole genome shotgun sequence
ATGAATAAAATGATTACATTTAGTTTAATCTTTTTATCAACATATTCTTTTGCGGAAAGCAGTATTACGC
AAGAGCAAAAATTCACAGAGGCTGAGGGGCCTTTTTGTCAATATTCTCTAAAAGCAAATGGAACTTCATA
TGATTTTAGCTTTTTTGACTCATGTGGCACAAGCGATTTAATTAAATTGAATGAAGAGCTTTATTTGGTT
GACTTGACTAATGGTAATATAAATAGCGAAGCATACTTTATTTTTGACACAGAAAAAAAAGAAGTTCCAA
AAGAGATTGGTAGTTTGAACCTTAGTTATGACATTTACGATTATGGTTTTGATATTATCGATCATACATT
ATTGGACAGAGATAATGGTAAAATAATAAAAAACGCTAATAATAATTATACTGGCGTGTTGTCTTACATT
TTCCAGAGAGATAATTTTAATATGAATATACCTAAAGATAGGATTTTGTATTGGAATAGAAATGGAGAAG
AGAATTATTGTTCTTCTACAATAGTTTTTTCTGCTAATTATGACGAACATAGGCGAGATGTTTGCTGGAA
TAGTTTTTCATCAAGATATGAATATGTTGAGATTATTGAAGGTAGAGTAAGTTTAAGGATAAAGGGAGAG
TTTGATGGAAGGCAGTTTAAGTTTGATAATAATGGTGAAGAACTGACGATTAATCCATATAATGGAAAGT
ATAGTACTAACAAAACCAACGAAAAATTCCCTGATGAAGACTATTTTAATATAAAGTGA

Reference
(1) Salomon D et al. (2015). Type VI Secretion System Toxins Horizontally Shared between Marine Bacteria. PLoS Pathog. 11(8):e1005128. [PudMed:26305100] experimental
 
experimental experimental literature