SecReT6
Effector Protein ID: 91191162
-
SecReT6 ID939
T6SS type
Gene symbol-
Locus tagV12G01_03170
StrainVibrio alginolyticus 12G01
RepliconT6SS [GenBank: AAPS01000004] [Browse all T6SS(s) in this replicon]
Location [Strand]285525..285911 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorV12G01_03170
DescriptionImmunity protein of V12G01_03175
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 128 a.a.     [Download]
>gi|91191162|ref|EAS77428.1| hypothetical protein [Vibrio alginolyticus 12G01]
MQLIWNIIGYLMFSGVLVIFFQTFFIGIMHLLMPKDIVNSYFKEPYFNTFELALFTGWPYAFFRTLMFVR
LIVQPSSGEKRKLPDVSQEVPRWYRLLSFILIWVIIINSTMLALVFFIAGFLSLANHV
-
Nucleotide Sequence: 387 bp     [Download]
>gi|91190880|ref|AAPS01000004.1|:285525-285911 Vibrio alginolyticus 12G01 1100007009656, whole genome shotgun
ATGCAATTGATCTGGAACATTATTGGATACTTAATGTTCTCTGGTGTATTAGTTATTTTTTTTCAAACAT
TCTTTATAGGTATCATGCACCTTTTAATGCCAAAAGACATTGTCAATAGCTACTTTAAAGAACCTTATTT
TAACACTTTCGAACTAGCTCTATTTACAGGTTGGCCTTACGCATTTTTCCGAACATTGATGTTTGTTCGT
TTAATCGTTCAACCTAGCTCAGGTGAAAAGCGAAAGTTACCCGATGTATCCCAAGAGGTGCCTAGGTGGT
ACCGTCTATTATCCTTCATATTAATATGGGTAATTATCATAAACTCTACAATGTTAGCACTTGTATTTTT
TATCGCAGGTTTTTTATCACTAGCAAATCATGTATGA

Reference
(1) Salomon D et al. (2015). Type VI Secretion System Toxins Horizontally Shared between Marine Bacteria. PLoS Pathog. 11(8):e1005128. [PudMed:26305100] experimental
 
experimental experimental literature