SecReT6
Effector Protein ID: 91191211
-
SecReT6 ID939
T6SS type
Gene symbol-
Locus tagV12G01_18282
StrainVibrio alginolyticus 12G01
RepliconT6SS [GenBank: AAPS01000003] [Browse all T6SS(s) in this replicon]
Location [Strand]28674..29573 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorV12G01_18282
DescriptionImmunity protein of V12G01_18287.
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Imm49 [PF15575], Evalue: 3.8e-42, Aligned region: 70..283
Protein Sequence: 299 a.a.     [Download]
>gi|91191211|ref|EAS77476.1| hypothetical protein [Vibrio alginolyticus 12G01]
MVDNSKVKKVERVAHVELSDFEREAYREEIKESLDKRKRRISIKRENLVYLSDGISYQLRLYTWLPPLDD
DERIGTLCLYESSLMRAFYHQLAIKPSEPQSIKLPDYPEVTWKGEGILKTGCLHPNRWLDAYFTSVIVRD
KASMDVLANFPISLMRQSSTKAGELSYMLVDVIQSFHNRTSDYPDKLVAAMDAAVAQGDNWALEIAMGIL
ETFAALTTNIGYDFEEVLVKNLQFQEKYHLRELGPDRIGIRTFVNFPLLGMACMWYDKGNRLSVETGWLP
PYLVEGRWLEEVKAGKISR
-
Nucleotide Sequence: 900 bp     [Download]
>gi|91191178|ref|AAPS01000003.1|:c29573-28674 Vibrio alginolyticus 12G01 1100007009692, whole genome shotgun sequence
ATGGTTGATAACTCAAAGGTAAAAAAGGTTGAACGAGTAGCTCATGTTGAACTAAGTGATTTTGAAAGAG
AAGCTTATCGAGAAGAGATAAAAGAGAGCTTAGACAAAAGGAAAAGGCGCATATCTATAAAACGAGAAAA
CTTGGTTTACTTGAGCGATGGTATTTCTTATCAGCTCCGTTTGTATACATGGTTACCTCCATTAGATGAT
GATGAGAGAATCGGCACGCTATGCCTATATGAATCATCATTGATGCGTGCTTTTTACCATCAACTTGCCA
TCAAACCAAGCGAGCCTCAAAGCATTAAATTACCTGATTATCCAGAAGTGACCTGGAAAGGTGAAGGTAT
TTTGAAAACTGGATGCTTACACCCTAATCGATGGTTAGATGCCTATTTTACCTCTGTCATCGTCCGTGAC
AAAGCTAGCATGGATGTGTTGGCGAACTTTCCGATTTCTTTGATGAGACAGAGCTCTACTAAAGCGGGTG
AATTGTCTTACATGTTAGTAGATGTCATCCAGTCGTTTCATAATCGCACATCGGACTATCCTGATAAACT
CGTCGCAGCAATGGACGCAGCGGTAGCCCAAGGGGATAACTGGGCGTTGGAAATTGCGATGGGGATCCTA
GAAACCTTCGCAGCGCTCACTACTAACATTGGTTATGATTTTGAGGAAGTGCTCGTTAAAAACCTACAGT
TTCAAGAGAAATATCATCTTCGAGAATTAGGACCCGACAGGATAGGCATCCGAACTTTTGTTAACTTCCC
TCTTCTTGGCATGGCATGTATGTGGTATGACAAAGGTAACCGTTTATCTGTTGAAACTGGTTGGCTCCCT
CCCTATCTTGTCGAAGGACGTTGGCTAGAAGAAGTAAAAGCCGGGAAGATCTCTCGATAA

Reference
(1) Salomon D et al. (2015). Type VI Secretion System Toxins Horizontally Shared between Marine Bacteria. PLoS Pathog. 11(8):e1005128. [PudMed:26305100] experimental
 
experimental experimental literature