SecReT6
Immunity Protein ID: 116049797
SecReT6 ID150
T6SS typeA3
Gene symbol-
Locus tagPA14_40650
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]3629785..3630303 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA1845
DescriptionTsi1
UniProt IDQ02KZ0
KEGG IDpau:PA14_40650
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 172 a.a.     [Download]
>gi|116049797|ref|YP_791396.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MKLLAGSFAALFLSLSAQASDCTFTQLEIVPQFGSPNMFGGEDEHVRVMFSNEDPNDDNPDAFPEPPVYL
ADRDSGNDCRIEDGGIWSRGGVFLSQDGRRVLMHEFSGSSAELVSYDSATCKVVHREDISGQRWAVDKDG
LRLGQKCSGESVDSCAKVVTRSLAPFCQTAKK
-
Nucleotide Sequence: 519 bp     [Download]
>gi|116048575|ref|NC_008463.1|:3629785-3630303 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGAAACTGCTCGCCGGCAGCTTCGCCGCTCTCTTCCTGAGCCTTTCGGCCCAGGCGTCGGACTGTACTT
TCACCCAGCTGGAAATCGTGCCCCAGTTCGGCTCGCCGAACATGTTCGGCGGCGAGGACGAGCACGTCCG
CGTGATGTTCAGCAACGAGGATCCCAACGACGACAACCCCGATGCCTTTCCCGAACCGCCGGTCTACCTG
GCTGACCGCGACAGCGGCAACGATTGCCGCATAGAGGACGGCGGCATCTGGTCGCGCGGCGGCGTGTTCC
TGAGCCAGGACGGCCGGCGCGTGCTGATGCATGAATTCAGCGGCTCCAGCGCCGAGCTGGTGTCCTACGA
CAGCGCTACCTGCAAGGTGGTGCACCGCGAGGACATCTCCGGCCAGCGCTGGGCGGTGGACAAGGACGGG
CTGCGCCTGGGTCAGAAATGCTCGGGCGAATCCGTCGACAGCTGCGCGAAGGTCGTGACGCGTTCCCTCG
CGCCGTTCTGCCAGACCGCAAAGAAATGA