SecReT6
Immunity Protein ID: 116050688
SecReT6 ID150
T6SS typeA3
Gene symbol-
Locus tagPA14_29190
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]2524349..2524582 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA2703
DescriptionTsi2
UniProt IDQ02NJ4
KEGG IDpau:PA14_29190
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 77 a.a.     [Download]
>gi|116050688|ref|YP_790492.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MNLKPQTLMVAIQCVAARTRELDAQLQNDDPQNAAELEQLLVGYDLAADDLKNAYEQALGQYSGLPPYDR
LIEDPVS
-
Nucleotide Sequence: 234 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c2524582-2524349 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGAACCTGAAACCCCAGACCCTGATGGTGGCGATCCAGTGCGTCGCCGCGCGCACCCGCGAACTCGACG
CGCAGTTGCAGAACGACGACCCGCAGAACGCCGCTGAACTCGAACAGTTGCTGGTCGGCTACGACCTCGC
CGCCGACGACCTGAAGAACGCCTACGAGCAAGCCCTGGGCCAATACAGCGGCCTGCCGCCCTATGACCGG
CTGATCGAAGACCCGGTGTCCTGA