SecReT6
Immunity Protein ID: 116050775
SecReT6 ID150
T6SS typeA3
Gene symbol-
Locus tagPA14_28200
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]2441012..2441449 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA2775
DescriptionTsi4
UniProt IDQ02NT2
KEGG IDpau:PA14_28200
PDB IDNA
Domain hit(s) vs Pfam DUF3592 [PF12158], Evalue: 4.70E-18, Aligned region: 9..131
Protein Sequence: 145 a.a.     [Download]
>gi|116050775|ref|YP_790404.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MTTSSGSRIGGLLHASLFSLLGLGLLLAGGFKTVERYHFLRTAQEAQGTVSALNAGGSHPQIDFTSVSGE
RISYPQGGFIFGYQVGEPVRVLYEAGRPAASAIVDDAGALWGNSAFLCGFGALFGIVGFRGLLGLRSSQP
TSKGH
-
Nucleotide Sequence: 438 bp     [Download]
>gi|116048575|ref|NC_008463.1|:2441012-2441449 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGACGACCTCTTCCGGTTCGCGTATCGGCGGACTTCTTCACGCTTCCCTTTTTTCCCTGCTCGGACTCG
GCCTCCTGCTCGCCGGCGGTTTCAAGACCGTCGAGCGGTACCATTTCCTGCGTACTGCGCAGGAAGCCCA
GGGGACGGTCAGCGCCTTGAATGCCGGTGGTTCGCATCCGCAGATCGATTTCACCAGCGTTTCCGGCGAG
CGGATTTCCTATCCCCAGGGCGGCTTCATCTTCGGCTACCAGGTGGGCGAGCCGGTTCGCGTCCTCTACG
AGGCTGGGCGGCCGGCGGCCAGCGCGATAGTCGACGATGCCGGCGCGCTCTGGGGAAACAGCGCTTTCCT
CTGCGGCTTCGGCGCACTCTTCGGTATTGTCGGGTTCAGGGGATTGCTGGGCCTGCGTTCTTCCCAACCG
ACCTCAAAAGGACATTGA