SecReT6
Immunity Protein ID: 116051503
SecReT6 ID150
T6SS typeA3
Gene symbol-
Locus tagPA14_19010
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T6SS(s) in this replicon]
Location [Strand]1641698..1642135 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA3485
DescriptionTsi3
UniProt IDQ02QX4
KEGG IDpau:PA14_19010
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 145 a.a.     [Download]
>gi|116051503|ref|YP_789662.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MKTVALFLASLALLACTAESGVDFDKTLTHPNGLVVERPVGFDARRSAEGFRFDEGGKLRNPRQLEVQRQ
DAPPSPDLASRRLGDGEARYKVEEDDGGSAGSEYRLWAAKPAGARWIVVSASEQSEDGEPTFALAWALLE
RARLQ
-
Nucleotide Sequence: 438 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c1642135-1641698 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGAAGACAGTCGCCCTGTTTCTCGCCAGCCTCGCCCTGCTGGCCTGCACCGCGGAGTCCGGGGTGGACT
TCGACAAGACCCTGACCCACCCGAACGGCCTGGTGGTGGAGCGCCCCGTCGGCTTCGACGCGCGGCGCAG
CGCCGAGGGCTTCCGCTTCGACGAAGGCGGCAAGCTGCGCAACCCACGCCAACTGGAGGTCCAGCGCCAG
GACGCGCCGCCCTCGCCCGACCTGGCGAGCAGGCGTCTGGGCGACGGCGAGGCGCGCTACAAGGTAGAGG
AAGACGACGGCGGCTCCGCAGGCAGCGAATACCGCCTGTGGGCAGCCAAGCCGGCGGGCGCGCGGTGGAT
CGTGGTCAGCGCCAGCGAGCAGAGCGAGGATGGCGAACCGACCTTCGCCCTGGCCTGGGCGCTGCTGGAG
CGGGCCAGGTTGCAATAG