SecReT6
Immunity Protein ID: 15595290
SecReT6 ID3
T6SS typeA3
Gene symbol-
Locus tagPA0092
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]113022..113306 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA0092 (Tsi6)
DescriptionTsi6
UniProt IDQ9I740
KEGG IDpae:PA0092
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 94 a.a.     [Download]
>gi|15595290|ref|NP_248782.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MTPIEYIDRALALVVDRLARYPGYEVLLSAEKQLQYIRSVLLDRSLDRSALHRLTLGSIAVKEFDETDPE
LSRALKDAYYVGIRTGRGLKVDLP
-
Nucleotide Sequence: 285 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c113306-113022 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGACACCCATCGAATACATCGACCGCGCTCTGGCGCTGGTCGTCGACCGGCTGGCCCGCTATCCGGGAT
ACGAGGTCCTGCTGTCTGCGGAAAAGCAATTGCAGTACATCAGGTCCGTCCTGCTCGACCGCAGCCTGGA
TCGTTCCGCACTGCACCGGTTGACCCTCGGCAGCATCGCCGTGAAGGAATTCGACGAAACCGACCCGGAA
CTCTCCAGGGCCCTCAAGGACGCCTACTACGTCGGTATACGCACTGGCCGCGGCCTGAAGGTCGATCTGC
CCTGA

Reference
(1) Whitney JC et al. (2014). Genetically distinct pathways guide effector export through the type VI secretion system. Mol Microbiol. 92(3):529-42. [PudMed:24589350] experimental
 
experimental experimental literature