SecReT6
Immunity Protein ID: 15595458
SecReT6 ID4
T6SS typeA1
Gene symbol-
Locus tagPA0261
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H2-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]293301..293798 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA0261
DescriptionTli3
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 165 a.a.     [Download]
>gi|15595458|ref|NP_248952.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MKCKTLLIACLFGLGSAQALAVSKLPPQIPVHAGSGRVTLDLRPLLAETNDVEITRVSVCRRVGSHCQET
LWRIELPPGWRAGEIEVFGDYPGSSVLLRRPERLQPDGSYNAFIHFNERSRRHRQTVSSIAVEFCLAGEP
GNWMLLDEATCLARRNAEERQGEKP
-
Nucleotide Sequence: 498 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c293798-293301 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGAAATGCAAGACCTTGCTCATTGCCTGCCTGTTCGGCCTGGGAAGCGCCCAGGCCCTGGCCGTTTCCA
AACTGCCACCGCAGATCCCGGTGCACGCCGGCTCCGGGCGCGTGACACTGGATCTACGCCCCTTGCTGGC
GGAAACCAACGACGTCGAGATCACCCGTGTTTCGGTATGTCGGCGGGTCGGCAGCCATTGCCAGGAAACG
CTGTGGCGGATCGAGCTCCCGCCCGGGTGGCGTGCCGGGGAGATCGAGGTCTTCGGCGACTATCCCGGCT
CCAGCGTGCTCCTGCGCCGGCCGGAGCGCTTGCAGCCAGATGGGAGCTACAACGCATTCATTCATTTCAA
CGAGCGTAGCCGTCGGCACCGGCAAACGGTTTCCAGCATTGCCGTCGAATTCTGCCTGGCCGGCGAACCT
GGCAACTGGATGCTGCTCGACGAAGCGACCTGCCTGGCACGACGCAACGCCGAGGAGCGGCAAGGAGAGA
AGCCATGA

Reference
(1) Berni B, Soscia C, Djermoun S, Ize B, Bleves S (2019). A Type VI Secretion System Trans-Kingdom Effector Is Required for the Delivery of a Novel Antibacterial Toxin in Pseudomonas aeruginosa. Front Microbiol. 10:1218. [PudMed:31231326] experimental
 
experimental experimental literature