SecReT6
Immunity Protein ID: 15597042
SecReT6 ID3
T6SS typeA3
Gene symbol-
Locus tagPA1845
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]2004374..2004892 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA1845 (Tsi1,Tai1)
DescriptionTsi1
UniProt IDQ9I2Q0
KEGG IDpae:PA1845
PDB ID4EQA, 4FQB, 4FGI, 3VPJ
Domain hit(s) vs Pfam NA
Protein Sequence: 172 a.a.     [Download]
>gi|15597042|ref|NP_250536.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MKLLAGSFAALFLSLSAQAADCTFTQLEIVPQFGSPNMFGGEDEHVRVMFSNEDPNDDNPDAFPEPPVYL
ADRDSGNDCRIEDGGIWSRGGVFLSQDGRRVLMHEFSGSSAELVSYDSATCKVVHREDISGQRWAVDKDG
LRLGQKCSGESVDSCAKIVKRSLAPFCQTAKK
-
Nucleotide Sequence: 519 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c2004892-2004374 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGAAACTGCTCGCCGGCAGCTTCGCCGCTCTCTTCCTGAGCCTTTCGGCCCAGGCGGCGGACTGTACTT
TCACCCAGCTGGAAATCGTGCCCCAGTTCGGCTCGCCGAACATGTTCGGCGGCGAGGACGAGCACGTCCG
CGTGATGTTCAGCAACGAGGATCCCAACGACGACAACCCCGATGCCTTTCCCGAACCGCCGGTCTACCTG
GCCGACCGCGACAGCGGCAACGATTGCCGCATAGAGGACGGCGGCATCTGGTCGCGCGGCGGCGTGTTCC
TGAGCCAGGACGGCCGGCGCGTGCTGATGCATGAATTCAGCGGCTCCAGCGCCGAGCTGGTGTCCTACGA
CAGCGCCACCTGCAAGGTGGTGCACCGCGAGGACATCTCCGGCCAGCGCTGGGCGGTGGACAAGGACGGG
CTGCGCCTGGGTCAGAAATGCTCGGGCGAATCCGTCGACAGCTGCGCGAAGATCGTGAAGCGTTCGCTCG
CGCCGTTCTGCCAGACCGCAAAGAAATGA

Reference
(1) Hood RD et al. (2010). A type VI secretion system of Pseudomonas aeruginosa targets a toxin to bacteria. Cell Host Microbe. 7(1):25-37. [PudMed:20114026] experimental
 
experimental experimental literature