SecReT6
Immunity Protein ID: 15597899
SecReT6 ID3
T6SS typeA3
Gene symbol-
Locus tagPA2703
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]3057376..3057609 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA2703 (Tsi2)
DescriptionTsi2
UniProt IDQ9I0D9
KEGG IDpae:PA2703
PDB ID3STQ, 3VPV, 3RQ9
Domain hit(s) vs Pfam NA
Protein Sequence: 77 a.a.     [Download]
>gi|15597899|ref|NP_251393.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MNLKPQTLMVAIQCVAARTRELDAQLQNDDPQNAAELEQLLVGYDLAADDLKNAYEQALGQYSGLPPYDR
LIEEPAS
-
Nucleotide Sequence: 234 bp     [Download]
>gi|110645304|ref|NC_002516.2|:3057376-3057609 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGAACCTGAAACCCCAGACCCTGATGGTGGCGATCCAGTGCGTCGCCGCGCGCACCCGCGAACTCGACG
CGCAGTTGCAGAACGACGACCCGCAGAACGCCGCTGAACTCGAACAGTTGCTGGTCGGCTACGACCTCGC
CGCCGACGACCTGAAGAACGCCTACGAGCAAGCCCTGGGCCAATACAGCGGCCTGCCGCCCTATGACCGG
CTGATCGAAGAGCCGGCATCCTGA

Reference
(1) Hood RD et al. (2010). A type VI secretion system of Pseudomonas aeruginosa targets a toxin to bacteria. Cell Host Microbe. 7(1):25-37. [PudMed:20114026] experimental
 
experimental experimental literature