SecReT6
Immunity Protein ID: 15597971
SecReT6 ID3
T6SS typeA3
Gene symbol-
Locus tagPA2775
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]3132821..3133258 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA2775 (Tsi4)
DescriptionTsi4
UniProt IDQ9I068
KEGG IDpae:PA2775
PDB IDNA
Domain hit(s) vs Pfam DUF3592 [PF12158], Evalue: 3.40E-18, Aligned region: 9..131
Protein Sequence: 145 a.a.     [Download]
>gi|15597971|ref|NP_251465.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MTTSSGSRIGGLLHASLFSLLGLGLLLAGGFKTVERYHFLRTAQEAQGTVSALNAGGSHPQIDFTSVSGE
RISYPQGGFIFGYQVGEPVRVLYEAGRPAASAIVDDAGALWGTGAFLCGFGALFGIVGFRGLLGLRSSQP
TSKGH
-
Nucleotide Sequence: 438 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c3133258-3132821 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGACGACCTCTTCCGGTTCGCGTATCGGCGGACTTCTTCACGCTTCCCTTTTTTCCCTGCTCGGACTCG
GTCTCCTGCTCGCCGGCGGTTTCAAGACCGTCGAGCGGTACCATTTCCTGCGTACTGCGCAGGAAGCCCA
GGGGACGGTCAGCGCCTTGAATGCCGGCGGTTCGCATCCGCAGATCGATTTCACCAGCGTTTCCGGCGAG
CGGATTTCCTATCCCCAGGGCGGCTTCATCTTCGGCTACCAGGTGGGCGAGCCGGTTCGCGTCCTCTACG
AGGCTGGGCGGCCGGCGGCCAGCGCGATAGTCGACGATGCCGGCGCGCTCTGGGGAACCGGCGCTTTCCT
CTGCGGCTTCGGCGCACTCTTCGGTATTGTCGGGTTCAGGGGATTGCTGGGCCTGCGTTCTTCCCAACCG
ACCTCAAAAGGACATTGA

Reference
(1) Whitney JC et al. (2014). Genetically distinct pathways guide effector export through the type VI secretion system. Mol Microbiol. 92(3):529-42. [PudMed:24589350] experimental
 
experimental experimental literature