SecReT6
Immunity Protein ID: 15598681
SecReT6 ID3
T6SS typeA3
Gene symbol-
Locus tagPA3485
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]3899501..3899938 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA3485 (Tsi3,Tgi1)
DescriptionTsi3
UniProt IDQ9HYC4
KEGG IDpae:PA3485
PDB ID4N88, 3WA5, 4LUQ, 4N7S, 4N80, 4M5F
Domain hit(s) vs Pfam NA
Protein Sequence: 145 a.a.     [Download]
>gi|15598681|ref|NP_252175.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MKTVALILASLALLACTAESGVDFDKTLTHPNGLVVERPVGFDARRSAEGFRFDEGGKLRNPRQLEVQRQ
DAPPPPDLASRRLGDGEARYKVEEDDGGSAGSEYRLWAAKPAGARWIVVSASEQSEDGEPTFALAWALLE
RARLQ
-
Nucleotide Sequence: 438 bp     [Download]
>gi|110645304|ref|NC_002516.2|:3899501-3899938 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGAAGACAGTCGCCCTGATTCTCGCCAGCCTCGCCCTGCTGGCCTGCACCGCGGAGTCCGGGGTGGACT
TCGACAAGACCCTGACCCACCCGAACGGCCTGGTGGTGGAGCGCCCCGTCGGCTTCGACGCGCGGCGCAG
CGCCGAGGGCTTCCGCTTCGACGAAGGCGGCAAGCTGCGCAACCCACGCCAACTGGAGGTCCAGCGCCAG
GACGCGCCGCCCCCGCCCGACCTGGCGAGCAGGCGCCTGGGCGACGGCGAGGCGCGCTACAAGGTAGAGG
AAGACGACGGCGGCTCCGCCGGCAGCGAATACCGCCTGTGGGCAGCCAAGCCGGCGGGCGCGCGGTGGAT
CGTGGTCAGCGCCAGCGAGCAGAGCGAGGATGGCGAACCGACCTTCGCCCTGGCCTGGGCGCTGCTGGAG
CGGGCCAGGTTGCAATAG

Reference
(1) Hood RD et al. (2010). A type VI secretion system of Pseudomonas aeruginosa targets a toxin to bacteria. Cell Host Microbe. 7(1):25-37. [PudMed:20114026] experimental
 
experimental experimental literature