SecReT6
Immunity Protein ID: 15598684
SecReT6 ID4
T6SS typeA1
Gene symbol-
Locus tagPA3488
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H2-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]3906391..3907089 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA3488 (Tli5)
DescriptionTli5
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 232 a.a.     [Download]
>gi|15598684|ref|NP_252178.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MEAKIPLAKIYEHDLGIPDSHILGSKNIPFHVLLWRNQRVYYFTFSKPTENSAQRIKDLIARFRTRELYE
VPNEPGICFPYGFIADDGKTAYELKNSLRFTRTPNVIFSLLTASANDPWQTRPTSGLYDSDFRPGYDRQK
WKKSALLDSLHIGKRLAAFEGWRLDPRPDSGERERAWFGLAHTGGTLDPLVAIQVQTFQKGTDDLTDYTP
PPEEVLPRLKALSQSIEQRLAR
-
Nucleotide Sequence: 699 bp     [Download]
>gi|110645304|ref|NC_002516.2|:3906391-3907089 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGGAGGCCAAGATTCCTCTCGCCAAGATCTACGAACACGATCTCGGCATCCCCGACTCCCATATCCTTG
GCAGCAAGAATATCCCCTTCCATGTCCTGCTCTGGCGCAACCAGCGGGTCTATTACTTCACCTTCTCCAA
GCCGACCGAGAACTCCGCCCAGCGCATCAAGGACCTAATCGCCCGTTTCCGCACCCGCGAGCTTTACGAA
GTGCCGAACGAACCGGGCATCTGCTTCCCCTACGGCTTTATCGCCGACGACGGCAAGACCGCCTACGAAT
TGAAGAACAGCCTGCGTTTCACCCGCACGCCCAACGTGATCTTCAGCCTGCTCACCGCCTCGGCCAACGA
TCCCTGGCAGACCCGTCCCACCAGCGGCCTCTACGACAGCGACTTCCGTCCCGGCTACGACCGGCAGAAA
TGGAAAAAAAGCGCGCTGCTCGACAGCCTCCACATCGGCAAGCGCCTGGCCGCCTTCGAAGGCTGGCGCC
TCGACCCGCGCCCCGACTCCGGCGAACGGGAACGCGCCTGGTTCGGCCTGGCCCATACAGGCGGCACCCT
CGATCCGCTGGTAGCGATCCAGGTGCAGACCTTCCAGAAAGGCACCGACGACCTCACCGACTACACCCCG
CCCCCCGAAGAAGTACTGCCCCGCCTGAAGGCCCTGAGCCAAAGCATCGAGCAGCGGCTGGCGCGCTGA

Reference
(1) Russell AB et al. (2013). Diverse type VI secretion phospholipases are functionally plastic antibacterial effectors. Nature. 496(7446):508-12. [PudMed:23552891] experimental
 
experimental experimental literature