SecReT6
Immunity Protein ID: 156977994
SecReT6 ID229
T6SS typeA1
Gene symbol-
Locus tagVIBHAR_06790
StrainVibrio harveyi ATCC BAA-1116
Repliconchromosome II [GenBank: NC_009784] [Browse all T6SS(s) in this replicon]
Location [Strand]1912367..1913020 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityv12G01_02260
Descriptionv12G01_02260
UniProt IDA7N241
KEGG IDvca:M892_18605 vha:VIBHAR_06790
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 217 a.a.     [Download]
>gi|156977994|ref|YP_001448900.1| hypothetical protein VIBHAR_06790 [Vibrio harveyi ATCC BAA-1116]
MKYRFLIAVSMCFLLNGCFESKPVSVASIGNAGSLGGPHFIRDMWVSDIYGGGSNFAYGSVQGCCKSASI
GIGIPSAIKGEWENGVGGGSSREKWQKRWKPEWGNFDENYDTKWFRIDDVIDSELAKKKIETMNHYYKNH
HVNPVMKLLVNDDKVMLLYSILCVKSANDDCTVNEGADPNGWIVPSPNRHPKSVAVVTVLYDGKGEVSDK
PFTENTP
-
Nucleotide Sequence: 654 bp     [Download]
>gi|156975952|ref|NC_009784.1|:c1913020-1912367 Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence
ATGAAGTATAGATTTTTAATTGCTGTAAGCATGTGCTTTTTACTTAATGGTTGCTTTGAGAGTAAGCCTG
TTTCAGTCGCGAGTATTGGCAATGCAGGGTCATTAGGTGGCCCTCATTTTATTCGTGATATGTGGGTCAG
TGACATCTATGGTGGAGGCTCAAATTTTGCGTATGGGAGCGTTCAGGGCTGTTGTAAAAGTGCAAGCATT
GGAATTGGTATCCCTAGCGCTATAAAAGGCGAATGGGAAAATGGAGTTGGTGGCGGCTCATCTCGTGAAA
AGTGGCAAAAGCGTTGGAAGCCCGAATGGGGTAATTTTGATGAGAATTATGATACTAAATGGTTTCGAAT
TGATGATGTGATAGACAGTGAGCTTGCCAAGAAAAAAATAGAAACAATGAACCATTACTACAAGAACCAT
CATGTAAACCCAGTCATGAAGCTTCTTGTTAATGATGACAAAGTTATGCTTCTGTATTCTATCTTGTGTG
TGAAGTCTGCAAATGATGACTGCACGGTTAACGAAGGTGCAGATCCTAATGGATGGATAGTTCCTTCCCC
TAATAGACACCCTAAGAGCGTCGCTGTCGTTACCGTCTTATATGATGGTAAAGGAGAAGTGTCTGACAAA
CCATTTACGGAAAATACACCTTAG