SecReT6
Immunity Protein ID: 16759264
SecReT6 ID24
T6SS typeA3
Gene symbol-
Locus tagSTY0301
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T6SS(s) in this replicon]
Location [Strand]314619..315044 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunitySTY0301
DescriptionTai2_TY
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 141 a.a.     [Download]
>gi|16759264|ref|NP_454881.1| hypothetical protein STY0301 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MQKPILSLNSTCIVGGILWLLPVIVVHADEIVCPAVIHFSQAPIISSAEGWNVSSRAARMLNDGGFLSSG
DPKEQADLKGEDAVVDGKKGHLWEIDPEDNRRGIWFSCSYGQWAVLLARKVQGTVATCWSPDVLPAKLIC
K
-
Nucleotide Sequence: 426 bp     [Download]
>gi|16758993|ref|NC_003198.1|:314619-315044 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGCAGAAGCCTATTTTATCGTTGAATAGCACCTGTATTGTCGGGGGCATTCTGTGGTTACTTCCGGTAA
TAGTTGTTCATGCCGATGAGATTGTCTGCCCTGCGGTTATTCATTTTTCTCAGGCTCCAATAATTTCCTC
AGCGGAAGGATGGAATGTCTCATCCCGTGCAGCGCGTATGTTGAATGATGGTGGTTTTCTTTCGTCTGGC
GATCCCAAAGAGCAGGCAGATCTGAAAGGTGAAGATGCAGTCGTTGATGGGAAAAAGGGGCACCTGTGGG
AGATAGACCCAGAGGATAATCGCCGGGGGATCTGGTTCTCGTGTAGTTATGGACAGTGGGCTGTTCTGCT
TGCCAGAAAAGTTCAGGGAACGGTTGCGACATGCTGGAGCCCGGATGTCTTACCGGCGAAATTGATTTGT
AAATAA