SecReT6
Immunity Protein ID: 16761301
SecReT6 ID24
T6SS typeA3
Gene symbol-
Locus tagSTY2607
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T6SS(s) in this replicon]
Location [Strand]2442302..2442820 [+]
Productlipoprotein
immunity typeProtein
Homologous immunitySTY2607
DescriptionTai3_TY
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3828 [PF12883], Evalue: 3.90E-40, Aligned region: 24..141
Protein Sequence: 172 a.a.     [Download]
>gi|16761301|ref|NP_456918.1| lipoprotein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MKTFSLVALILLLCSCSAPHHDSTQAVKQFYTSWMTTFMNDVNTPDDTTALMQRYVAKEVIHRLALIQSL
YEQEIVGADYFMYAQDYAPEWIPQLRVGKAHPFLGGEKVDVLLATESTPIHLEVYTRWEEGRWKIYRVRD
ADKDYEQPIYDAGAITQAEAWSAKVAPEYEKH
-
Nucleotide Sequence: 519 bp     [Download]
>gi|16758993|ref|NC_003198.1|:2442302-2442820 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGAAAACGTTCTCCCTTGTCGCGCTTATCCTGTTGCTTTGTAGTTGCTCTGCGCCTCATCACGACAGTA
CGCAGGCCGTGAAGCAGTTCTATACCTCATGGATGACGACGTTCATGAACGATGTGAATACCCCTGACGA
CACCACCGCCTTAATGCAACGTTACGTTGCTAAAGAGGTTATTCATCGCCTGGCGCTAATACAGTCCCTT
TATGAACAGGAGATTGTAGGGGCAGATTATTTTATGTATGCGCAGGACTATGCGCCAGAGTGGATTCCAC
AGTTACGGGTTGGGAAGGCACACCCTTTCCTCGGCGGAGAAAAAGTGGATGTTCTGTTGGCTACAGAGTC
AACGCCCATCCACCTGGAAGTTTATACCCGTTGGGAAGAGGGACGCTGGAAAATTTACCGCGTTCGGGAT
GCTGATAAGGATTATGAACAGCCGATTTATGACGCAGGCGCCATCACCCAGGCTGAGGCCTGGTCAGCAA
AAGTCGCGCCGGAATATGAGAAGCATTAA

Reference
(1) Russell AB et al. (2012). A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 11(5):538-49. [PudMed:22607806] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature