SecReT6
Immunity Protein ID: 194443478
SecReT6 ID293
T6SS typeA3
Gene symbol-
Locus tagSNSL254_A0304
StrainSalmonella enterica subsp. enterica serovar Newport str. SL254
Repliconchromosome [GenBank: NC_011080] [Browse all T6SS(s) in this replicon]
Location [Strand]320384..320716 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunitySTM0278
DescriptionTai4_TM
UniProt IDB4SV54
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 110 a.a.     [Download]
>gi|194443478|ref|YP_002039512.1| unnamed protein product [Salmonella enterica subsp. enterica serovar Newport str. SL254]
MLVWQPSFAQEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIA
KKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
-
Nucleotide Sequence: 333 bp     [Download]
>gi|194442203|ref|NC_011080.1|:320384-320716 Salmonella enterica subsp. enterica serovar Newport str. SL254 chromosome, complete genome
ATGCTGGTATGGCAGCCATCCTTTGCACAAGAAGCATTGACCACACAATATTCACAGTCGGAACTCTTAA
AAAATTGGGCGCTGAGTCATTGTCTGGCATTAGTATACAAAGATGATGTCGTTAAAAACGATGCCAGAGC
TACGGCCAGTGCTTACCTTGAATATGGTAAACAATCTGTGGAGATTTACCATGAAATTGATGAGATTGCG
AAAAAATATTCAGGGTTGAAATATAACGGTTCGATATCATCAGATTTTAATACCATGAAGTGCATAGATT
TTATCCATGACAGGGAATTAAATGAATTAATTAAAAGGCGTGTCGAGAAGTAA