SecReT6
Immunity Protein ID: 197361661
SecReT6 ID297
T6SS typeA3
Gene symbol-
Locus tagSSPA0452
StrainSalmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
Repliconchromosome [GenBank: NC_011147] [Browse all T6SS(s) in this replicon]
Location [Strand]560142..560660 [-]
Productlipoprotein
immunity typeProtein
Homologous immunitySTY2607
DescriptionTai3_TY
UniProt IDB5BCH0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3828 [PF12883], Evalue: 1.60E-40, Aligned region: 24..141
Protein Sequence: 172 a.a.     [Download]
>gi|197361661|ref|YP_002141297.1| lipoprotein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
MKTFSLVALILLLCSCSAPHHDSTQAVKQFYTSWMTTFTNDVNTPDDTTALMQRYVAKEVIHRLALIQSL
YEQEIVGADYFMYAQDYAPEWIPQLRVGKAHPFLGGEKVDVLLATESTPIHLEVYTRWEEGRWKIYRVRD
ADRGYEQPIYDAGAITQAEAWSAKVAPEYKKH
-
Nucleotide Sequence: 519 bp     [Download]
>gi|197361212|ref|NC_011147.1|:c560660-560142 Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 chromosome, complete genome
ATGAAAACGTTCTCCCTTGTCGCGCTTATCCTGTTGCTTTGTAGTTGCTCTGCGCCTCATCACGACAGTA
CGCAGGCCGTGAAGCAGTTCTATACCTCATGGATGACGACGTTCACGAACGATGTGAATACCCCTGACGA
CACCACCGCCTTAATGCAACGTTACGTTGCTAAAGAGGTTATTCATCGCCTGGCGCTAATACAGTCCCTT
TATGAACAGGAGATTGTGGGGGCAGATTATTTTATGTATGCGCAGGACTATGCGCCAGAGTGGATTCCAC
AGTTACGGGTTGGGAAGGCACACCCTTTCCTCGGCGGAGAAAAAGTGGATGTTCTGTTGGCTACAGAGTC
AACGCCCATCCACCTGGAAGTTTATACCCGTTGGGAAGAGGGACGCTGGAAAATTTACCGCGTTCGGGAT
GCTGACAGGGGTTATGAACAGCCGATTTATGACGCAGGCGCCATCACCCAGGCTGAGGCCTGGTCAGCGA
AAGTCGCGCCGGAATATAAGAAGCATTAA