SecReT6
Immunity Protein ID: 198242944
SecReT6 ID301
T6SS typeA3
Gene symbol-
Locus tagSeD_A2729
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]2608446..2608964 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunitySTY2607
DescriptionTai3_TY
UniProt IDB5FPL9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3828 [PF12883], Evalue: 6.80E-41, Aligned region: 24..141
Protein Sequence: 172 a.a.     [Download]
>gi|198242944|ref|YP_002216448.1| hypothetical protein SeD_A2729 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MKTFSLVALILLLCSCSTPHHDSTQAVKQFYTSWMTTFTNDVNPPDDTTALMQRYVAKEVIHRLALIQSL
YEQEIVGADYFMYAQDYAPEWIPQLRVGKAHPFLGGEKVDVLLATESTPIHLEVYTRWEEGRWKIYRVRD
ADRGYEQPIYDAGAITQAEAWSAKVAPEYKKH
-
Nucleotide Sequence: 519 bp     [Download]
>gi|198241740|ref|NC_011205.1|:2608446-2608964 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGAAAACGTTCTCCCTTGTCGCGCTTATCCTGTTGCTTTGTAGTTGCTCCACGCCTCATCACGACAGTA
CGCAGGCCGTGAAGCAGTTCTATACCTCATGGATGACGACGTTCACGAACGATGTGAATCCCCCTGACGA
CACCACCGCCTTAATGCAACGTTACGTTGCCAAAGAGGTTATTCATCGCCTGGCGCTAATACAGTCCCTT
TATGAACAGGAGATTGTGGGGGCAGATTATTTTATGTATGCGCAGGACTATGCGCCAGAGTGGATTCCAC
AGTTACGGGTTGGGAAGGCACACCCTTTCCTCGGCGGAGAAAAAGTGGATGTTCTGTTGGCTACAGAGTC
AACGCCCATCCACCTGGAAGTTTATACCCGTTGGGAAGAGGGACGCTGGAAAATTTACCGCGTTCGGGAT
GCTGACAGGGGTTATGAACAGCCGATTTATGACGCAGGCGCCATCACCCAGGCTGAGGCCTGGTCAGCGA
AAGTCGCGCCGGAATATAAGAAGCATTAA