SecReT6
Immunity Protein ID: 218888837
SecReT6 ID324
T6SS typeA3
Gene symbol-
Locus tagPLES_00931
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]112103..112387 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA0092
DescriptionTsi6
UniProt IDB7V0X8
KEGG IDpag:PLES_00931
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 94 a.a.     [Download]
>gi|218888837|ref|YP_002437701.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MTPIEYIDRALALVVDRLARYPGYEVLLSAEKQLQYIRSVLLDRSLDRSALHRLTLGSIAVKEFDETDPE
LSRALKDAYYVGIRTGRGLKVDLP
-
Nucleotide Sequence: 285 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c112387-112103 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGACACCCATCGAATACATCGACCGCGCTCTGGCGCTGGTCGTCGACCGGCTGGCCCGCTATCCGGGAT
ACGAGGTCCTGCTGTCCGCGGAAAAGCAATTGCAGTACATCAGGTCCGTCCTGCTCGACCGCAGCCTGGA
TCGTTCCGCACTGCACCGGTTGACCCTCGGCAGCATCGCCGTGAAGGAATTCGACGAAACCGACCCGGAA
CTCTCCAGGGCCCTCAAGGACGCCTACTACGTCGGTATACGCACTGGCCGCGGCCTGAAAGTCGATCTGC
CCTGA