SecReT6
Immunity Protein ID: 218890267
SecReT6 ID324
T6SS typeA3
Gene symbol-
Locus tagPLES_15271
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]1658324..1658767 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA3485
DescriptionTsi3
UniProt IDB7UWJ5
KEGG IDpag:PLES_15271
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 147 a.a.     [Download]
>gi|218890267|ref|YP_002439131.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MKTVALILASLALLACTAESGVDFDKTLTHPNGLVVERPVGFDARRSAEGFRFDEGGKLRNPRQLEVQRQ
DAPPPPDLASRRLGDGEARYKVEVEEDDGGSAGSEYRLWAAKPAGTRWIVVSASEQSEDGEPTFALAWAL
LERARLQ
-
Nucleotide Sequence: 444 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c1658767-1658324 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGAAGACAGTCGCCCTGATTCTCGCCAGCCTCGCCCTGCTGGCCTGCACCGCGGAGTCCGGGGTGGACT
TCGACAAGACCCTGACCCACCCGAACGGCCTGGTGGTGGAGCGCCCCGTCGGCTTCGACGCGCGGCGCAG
CGCCGAGGGCTTCCGCTTCGACGAAGGCGGCAAGCTGCGCAACCCACGCCAACTGGAGGTCCAGCGCCAG
GACGCGCCGCCCCCGCCCGACCTGGCGAGCAGGCGCCTGGGCGACGGCGAGGCGCGCTACAAGGTAGAGG
TAGAGGAAGACGACGGCGGCTCCGCAGGCAGCGAATACCGCCTGTGGGCAGCCAAGCCGGCGGGCACGCG
GTGGATCGTGGTCAGCGCCAGCGAGCAGAGCGAGGATGGCGAACCGACCTTCGCCCTGGCCTGGGCGCTG
CTGGAGCGGGCCAGGTTGCAGTGA