SecReT6
Immunity Protein ID: 218891036
SecReT6 ID324
T6SS typeA3
Gene symbol-
Locus tagPLES_22991
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]2470393..2470830 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA2775
DescriptionTsi4
UniProt IDB7UYT6
KEGG IDpag:PLES_22991
PDB IDNA
Domain hit(s) vs Pfam DUF3592 [PF12158], Evalue: 1.70E-18, Aligned region: 9..131
Protein Sequence: 145 a.a.     [Download]
>gi|218891036|ref|YP_002439902.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MTTSSGSRIGGLLHASLFSLLGLGLLLAGGFKTVERYHFLRTAQEAQGTVSALNAGGSHPQIDFTSVSGE
RISYPQGGFIFGYQVGEPVRVLYEAGRPAASAIVDDAGALWGTSAFLCGFGALFGIVGFRGLLGLRSSQP
TSKGH
-
Nucleotide Sequence: 438 bp     [Download]
>gi|218888746|ref|NC_011770.1|:2470393-2470830 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGACGACCTCTTCCGGTTCGCGTATCGGCGGACTTCTTCACGCTTCCCTTTTTTCCCTGCTCGGACTCG
GTCTCCTGCTCGCCGGCGGTTTCAAGACCGTCGAGCGGTACCATTTCCTGCGTACTGCGCAGGAAGCCCA
GGGGACGGTCAGCGCCTTGAATGCCGGCGGTTCGCATCCGCAGATCGATTTCACCAGCGTTTCCGGCGAG
CGGATTTCCTATCCCCAGGGCGGCTTCATCTTCGGCTACCAGGTGGGCGAGCCGGTTCGCGTCCTCTACG
AGGCTGGGCGGCCGGCGGCCAGCGCGATAGTCGACGATGCCGGCGCGCTCTGGGGAACCAGCGCTTTCCT
CTGCGGCTTCGGCGCACTCTTCGGTATTGTCGGGTTCAGGGGATTGCTGGGCCTGCGTTCTTCCCAACCG
ACCTCAAAAGGACATTGA