SecReT6
Immunity Protein ID: 218891136
SecReT6 ID324
T6SS typeA3
Gene symbol-
Locus tagPLES_24011
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]2579264..2579497 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA2703
DescriptionTsi2
UniProt IDB7V7M8
KEGG IDpag:PLES_24011
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 77 a.a.     [Download]
>gi|218891136|ref|YP_002440002.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MNLKPQTLMVAIQCVAARTRELDAQLQNDDPQNAAELEQLLVGYDLAADDLKNAYEQALGQYSGLPPYDR
LIEEPAS
-
Nucleotide Sequence: 234 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c2579497-2579264 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGAACCTGAAACCCCAGACCCTGATGGTGGCGATCCAGTGCGTCGCCGCGCGCACCCGCGAACTCGACG
CGCAGTTGCAGAACGACGACCCGCAGAACGCCGCTGAACTCGAACAGTTGCTGGTCGGCTACGACCTCGC
CGCCGACGACCTGAAGAACGCCTACGAGCAAGCCCTGGGCCAATACAGCGGCCTGCCGCCCTATGACCGG
CTGATCGAAGAGCCGGCATCCTGA