SecReT6
Immunity Protein ID: 218892199
SecReT6 ID324
T6SS typeA3
Gene symbol-
Locus tagPLES_34801
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]3863191..3863709 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA1845
DescriptionTsi1
UniProt IDB7VB30
KEGG IDpag:PLES_34801
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 172 a.a.     [Download]
>gi|218892199|ref|YP_002441066.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MKLLAGSFAALFLSLSAQAADCTFTQLEIVPQFGSPNMFGGEDEHVRVMFSNEDPNDDNPDAFPEPPVYL
ADRDSGNDCRIEDGGIWSRGGVFLSQDGRRVLMHEFSGSSAELVSYDSATCKVVHREDISGQRWAVDKDG
LRLGEKCSGESVDSCAKIVKRSLAPFCQTAKK
-
Nucleotide Sequence: 519 bp     [Download]
>gi|218888746|ref|NC_011770.1|:3863191-3863709 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGAAACTGCTCGCCGGCAGCTTCGCCGCTCTCTTCCTGAGCCTTTCGGCCCAGGCGGCGGACTGTACTT
TCACCCAGCTGGAAATCGTGCCCCAGTTCGGCTCGCCGAACATGTTCGGCGGCGAGGACGAGCACGTCCG
CGTGATGTTCAGCAACGAGGATCCCAACGACGACAACCCCGATGCCTTTCCCGAACCGCCGGTCTACCTG
GCCGACCGCGACAGCGGCAACGATTGCCGCATAGAGGACGGCGGCATCTGGTCGCGCGGCGGCGTGTTCC
TGAGCCAGGACGGCCGGCGCGTGCTGATGCATGAATTCAGCGGCTCCAGCGCCGAGCTGGTGTCCTACGA
CAGCGCCACCTGCAAGGTGGTGCACCGCGAGGACATCTCCGGCCAGCGCTGGGCGGTGGACAAGGACGGG
CTGCGCCTGGGTGAGAAATGCTCGGGCGAATCCGTCGACAGCTGCGCGAAGATCGTGAAGCGTTCGCTCG
CGCCGTTCTGCCAGACCGCAAAGAAATGA