SecReT6
Immunity Protein ID: 218894185
SecReT6 ID325
T6SS typeA4a
Gene symbol-
Locus tagPLES_54761
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]6059279..6059920 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA5086
DescriptionPA5086
UniProt IDB7V3H9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Sel1 [PF08238], Evalue: 9.20E-11, Aligned region: 1..30
Sel1 [PF08238], Evalue: 9.20E-11, Aligned region: 37..71
Sel1 [PF08238], Evalue: 9.20E-11, Aligned region: 73..104
Sel1 [PF08238], Evalue: 9.20E-11, Aligned region: 105..136
Protein Sequence: 213 a.a.     [Download]
>gi|218894185|ref|YP_002443054.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MHNLANLYRTGWPGGVEKDTQKALDLYQKMIDLDVPQGFYDMGAMIGNRAGVKNPATDGLTFLDKAASLG
NPPALTELGKLYIYVAKKKDLGLAYTHCAASQGYAPASYELGAYYKIVEHNFPKALVYYQVSVSQGGKSA
AFFLSRVFGSETPPASAMWYAPDEKLREAYYSIYKKLEADPDLRFPNLIEDYPLPPHPTQGYDADHPDWK
PER
-
Nucleotide Sequence: 642 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c6059920-6059279 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGCATAATTTGGCGAATCTTTATCGTACAGGGTGGCCCGGAGGAGTAGAAAAAGATACGCAGAAGGCAT
TGGATCTCTATCAAAAGATGATAGATCTGGATGTGCCTCAGGGGTTCTATGATATGGGAGCAATGATTGG
AAATCGCGCCGGGGTTAAAAACCCTGCAACTGACGGACTTACTTTCCTTGATAAGGCTGCTAGCCTAGGA
AATCCGCCGGCACTAACTGAACTAGGTAAGCTTTATATATATGTGGCCAAAAAAAAGGATTTGGGGTTGG
CGTATACTCACTGTGCTGCTAGTCAGGGTTATGCGCCGGCTAGTTATGAGCTGGGGGCGTATTACAAGAT
AGTAGAGCACAATTTCCCAAAGGCACTGGTTTATTATCAGGTGTCAGTCTCTCAGGGGGGCAAGAGTGCG
GCTTTTTTCCTATCACGAGTCTTCGGAAGTGAGACTCCCCCTGCAAGTGCAATGTGGTACGCCCCCGACG
AAAAGTTGCGAGAAGCGTATTATTCAATCTACAAAAAGCTTGAAGCTGACCCCGACTTACGTTTCCCCAA
TCTGATAGAGGACTATCCTCTGCCTCCTCATCCCACCCAGGGCTACGACGCGGACCACCCAGACTGGAAG
CCGGAGCGGTAA