SecReT6
Immunity Protein ID: 218894186
SecReT6 ID325
T6SS typeA4a
Gene symbol-
Locus tagPLES_54771
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]6060157..6060978 [-]
Producthypothetical protein
immunity typeProtein
Homologous immunityPA5088
DescriptionPA5088
UniProt IDB7V3I0
KEGG IDpag:PLES_54771
PDB IDNA
Domain hit(s) vs Pfam Sel1 [PF08238], Evalue: 3.60E-13, Aligned region: 25..32
Sel1 [PF08238], Evalue: 3.60E-13, Aligned region: 48..57
Sel1 [PF08238], Evalue: 3.60E-13, Aligned region: 59..89
Sel1 [PF08238], Evalue: 3.60E-13, Aligned region: 97..131
Sel1 [PF08238], Evalue: 3.60E-13, Aligned region: 132..163
Sel1 [PF08238], Evalue: 3.60E-13, Aligned region: 165..197
TPR_7 [PF13176], Evalue: 0.0086, Aligned region: 60..95
TPR_7 [PF13176], Evalue: 0.0086, Aligned region: 134..142
TPR_7 [PF13176], Evalue: 0.0086, Aligned region: 181..191
Protein Sequence: 273 a.a.     [Download]
>gi|218894186|ref|YP_002443055.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MADSKPFVCVNEKDHLPPLDPQADAWYREAATLAKPDTLRPWPRIVDLYSKAVERGHWKAMHNLASLYRT
GWPGGVEKDTQKALDLYQKMIDLKVPQGFYDMAAMIGSRAGVKNPATDGLTFLDKAASLGNPPALTELGR
LYIYVAGQDELGLKYTNCAAGQGYAPANYELAMYYRLVAHNYPKAAGYYLLAASQGNNDAAFFMSGVFDK
TSPDVDRMWYAPDERLHKLYDGIYDQLSADPDLRFPNLIKDHPLPPHPTQGYDADRPDWKSGQ
-
Nucleotide Sequence: 822 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c6060978-6060157 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGGCTGACAGCAAGCCTTTTGTCTGCGTTAACGAAAAGGACCATCTACCCCCTCTGGACCCGCAGGCCG
ATGCTTGGTATCGCGAAGCGGCGACCCTGGCCAAGCCCGATACCTTGCGTCCGTGGCCTCGTATCGTCGA
TCTATACAGTAAGGCAGTTGAGCGTGGTCACTGGAAGGCTATGCATAACTTGGCGAGCCTCTATCGTACC
GGTTGGCCAGGCGGTGTGGAGAAGGATACTCAGAAAGCTCTAGATCTCTACCAGAAGATGATCGATTTGA
AGGTTCCTCAAGGTTTCTACGATATGGCGGCAATGATCGGGAGTCGCGCTGGCGTCAAGAATCCTGCGAC
TGATGGACTTACTTTTCTCGATAAGGCTGCAAGCTTGGGTAATCCACCAGCATTAACTGAGTTAGGAAGG
CTATATATATATGTTGCTGGTCAGGATGAGTTGGGGCTGAAATATACGAACTGTGCTGCAGGCCAGGGCT
ATGCTCCTGCCAATTACGAACTGGCGATGTACTATCGTTTGGTGGCACATAACTACCCAAAGGCGGCAGG
CTATTACCTTCTTGCTGCAAGCCAAGGAAATAATGATGCTGCCTTCTTCATGTCCGGAGTTTTTGATAAG
ACTAGTCCCGATGTTGACAGAATGTGGTACGCCCCCGATGAGAGGCTACACAAACTATATGATGGTATTT
ACGACCAACTTTCCGCTGATCCTGATTTGCGTTTTCCCAACTTGATAAAGGACCATCCTCTGCCTCCTCA
CCCGACCCAGGGCTACGACGCAGATCGGCCCGACTGGAAATCGGGGCAGTGA