SecReT6
Immunity Protein ID: 227081590
SecReT6 ID335
T6SS typeA1
Gene symbol-
Locus tagVCM66_1374
StrainVibrio cholerae M66-2
Repliconchromosome II [GenBank: NC_012578] [Browse all T6SS(s) in this replicon]
Location [Strand]1473975..1474718 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityVC1419
DescriptionTsiV1
UniProt IDC3LMB4
KEGG IDvcm:VCM66_1374
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 247 a.a.     [Download]
>gi|227081590|ref|YP_002810141.1| hypothetical protein VCM66_1374 [Vibrio cholerae M66-2]
MKLLNNLAIKKLISVVVLFIALFFLGYDYYQTSQPNIWGDEPDESYITISGKKPIDAYLEVWTHFWVTGD
ECEAYSYDLFGQKAHQGGKISQKITHDFAKDGSNFEFRIPYQTYKNSQNCIVELRDFSIQAHNDFDTVGF
AQLRFSPAGREYYNREVDLNSLITADNCNSDIFKSIRKEWAGAIGCHFYVDGKKKTKDEEFNAYTIYYDF
SKFNNDTVIHYDILAGENYRSEPLSSAQKTAVVSDDN
-
Nucleotide Sequence: 744 bp     [Download]
>gi|227080237|ref|NC_012578.1|:1473975-1474718 Vibrio cholerae M66-2 chromosome I, complete sequence
ATGAAGTTATTGAATAATCTTGCAATAAAAAAGCTAATCTCAGTTGTTGTACTATTCATTGCATTATTTT
TTCTTGGGTATGACTATTACCAGACTTCTCAACCTAATATTTGGGGTGATGAACCTGATGAGTCCTATAT
TACTATATCAGGCAAAAAGCCTATAGATGCTTATTTAGAAGTGTGGACTCATTTTTGGGTGACAGGAGAT
GAGTGTGAAGCTTATTCCTACGATTTATTTGGTCAAAAAGCCCATCAAGGAGGAAAAATAAGCCAGAAGA
TTACGCATGATTTTGCTAAAGATGGTTCAAATTTTGAATTTAGAATTCCTTACCAAACGTATAAGAACTC
ACAAAATTGTATAGTGGAATTAAGAGACTTTTCCATACAAGCTCATAATGATTTTGATACCGTAGGTTTT
GCTCAGTTGCGATTTTCTCCAGCAGGCAGAGAATATTACAATCGAGAGGTTGATCTAAACTCATTGATTA
CAGCAGATAATTGCAATAGTGATATATTTAAAAGTATAAGAAAAGAGTGGGCAGGAGCCATTGGTTGTCA
TTTTTATGTCGATGGAAAGAAAAAGACTAAAGATGAAGAATTCAACGCTTACACCATCTACTACGATTTT
TCGAAATTCAATAATGACACCGTGATTCATTACGATATTTTAGCCGGTGAAAACTATCGGTCAGAGCCTT
TGTCCTCAGCTCAAAAGACAGCAGTGGTATCTGATGATAATTAA