SecReT6
Immunity Protein ID: 227811909
SecReT6 ID335
T6SS typeA1
Gene symbol-
Locus tagVCM66_A0285
StrainVibrio cholerae M66-2
Repliconchromosome II [GenBank: NC_012580] [Browse all T6SS(s) in this replicon]
Location [Strand]307072..307422 [+]
Producthypothetical protein
immunity typeProtein
Homologous immunityVCA0286
DescriptionTsiH
UniProt IDC3LUV7
KEGG IDvcm:VCM66_A0285
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 116 a.a.     [Download]
>gi|227811909|ref|YP_002811919.1| hypothetical protein VCM66_A0285 [Vibrio cholerae M66-2]
MKKIIKWFAILLVSTCLAVVLLATFLFKFEYSVPNAQIIGQMIWFPEPTATGLSIVENKHPIYTIRITCG
SPDNICHEGLFEYKGNTLSKIEIRDFASYLGEEITLTNGETLEPMN
-
Nucleotide Sequence: 351 bp     [Download]
>gi|227811634|ref|NC_012580.1|:307072-307422 Vibrio cholerae M66-2 chromosome II, complete genome
ATGAAAAAAATCATAAAGTGGTTTGCAATCTTACTGGTATCAACCTGTCTTGCCGTAGTGCTCTTGGCTA
CGTTTCTTTTTAAATTTGAATATTCGGTACCAAATGCTCAGATTATTGGACAAATGATTTGGTTCCCAGA
GCCCACAGCAACGGGTCTCAGTATTGTAGAGAATAAACATCCTATCTATACGATTCGTATAACGTGTGGC
TCTCCGGATAATATTTGCCATGAAGGCCTATTTGAGTACAAAGGGAACACACTAAGCAAAATTGAGATAA
GAGATTTTGCTAGCTATTTAGGTGAAGAAATCACCTTAACGAATGGTGAAACCTTAGAACCTATGAATTG
A